Index of /metadata/


../
An.stop/                                           22-Feb-2021 12:18                   -
SpeedoMeterApp.main/                               22-Feb-2021 12:18                   -
a2dp.Vol/                                          22-Feb-2021 12:18                   -
aarddict.android/                                  22-Feb-2021 12:18                   -
acr.browser.lightning/                             22-Feb-2021 12:18                   -
ai.susi/                                           22-Feb-2021 12:18                   -
akk.astro.droid.moonphase/                         22-Feb-2021 12:18                   -
am.ed.exportcontacts/                              22-Feb-2021 12:18                   -
am.ed.importcontacts/                              22-Feb-2021 12:18                   -
am.zoom.mbrowser/                                  22-Feb-2021 12:18                   -
am.zoom.mlauncher/                                 22-Feb-2021 12:18                   -
amirz.dngprocessor/                                22-Feb-2021 12:18                   -
amirz.rootless.nexuslauncher/                      22-Feb-2021 12:18                   -
androdns.android.leetdreams.ch.androdns/           22-Feb-2021 12:18                   -
android.androidVNC/                                22-Feb-2021 12:18                   -
android.game.prboom/                               22-Feb-2021 12:18                   -
android.nachiketa.ebookdownloader/                 22-Feb-2021 12:18                   -
anupam.acrylic/                                    22-Feb-2021 12:18                   -
app.crescentcash.src/                              22-Feb-2021 12:18                   -
app.easytoken/                                     22-Feb-2021 12:18                   -
app.librenews.io.librenews/                        22-Feb-2021 12:18                   -
app.olauncher/                                     22-Feb-2021 12:18                   -
app.openconnect/                                   22-Feb-2021 12:18                   -
app.reading.stoic.stoicreading/                    22-Feb-2021 12:18                   -
app.varlorg.unote/                                 22-Feb-2021 12:18                   -
app.zeusln.zeus/                                   22-Feb-2021 12:18                   -
apps.amine.bou.readerforselfoss/                   22-Feb-2021 12:18                   -
apps.babycaretimer/                                22-Feb-2021 12:18                   -
apps.droidnotify/                                  22-Feb-2021 12:18                   -
apps.jizzu.simpletodo/                             22-Feb-2021 12:18                   -
aq.com.sharetobrowser/                             22-Feb-2021 12:18                   -
ar.rulosoft.mimanganu/                             22-Feb-2021 12:18                   -
arity.calculator/                                  22-Feb-2021 12:18                   -
at.bitfire.cadroid/                                22-Feb-2021 12:18                   -
at.bitfire.gfxtablet/                              22-Feb-2021 12:18                   -
at.bitfire.nophonespam/                            22-Feb-2021 12:18                   -
at.dasz.KolabDroid/                                22-Feb-2021 12:18                   -
at.fhhgb.mc.swip/                                  22-Feb-2021 12:18                   -
at.jclehner.rxdroid/                               22-Feb-2021 12:18                   -
at.linuxtage.companion/                            22-Feb-2021 12:18                   -
at.or.at.plugoffairplane/                          22-Feb-2021 12:18                   -
at.tacticaldevc.panictrigger/                      22-Feb-2021 12:18                   -
at.tomtasche.reader/                               22-Feb-2021 12:18                   -
at.univie.sensorium/                               22-Feb-2021 12:18                   -
at.zweng.bankomatinfos/                            22-Feb-2021 12:18                   -
at.zweng.bankomatinfos2/                           22-Feb-2021 12:18                   -
atitel.com.todoer/                                 22-Feb-2021 12:18                   -
atm.nasaimages/                                    22-Feb-2021 12:18                   -
atm.rocketguardian/                                22-Feb-2021 12:18                   -
atm.starun.game/                                   22-Feb-2021 12:18                   -
au.com.wallaceit.reddinator/                       22-Feb-2021 12:18                   -
au.id.micolous.farebot/                            22-Feb-2021 12:18                   -
awais.instagrabber/                                22-Feb-2021 12:18                   -
aws.apps.androidDrawables/                         22-Feb-2021 12:18                   -
aws.apps.usbDeviceEnumerator/                      22-Feb-2021 12:18                   -
axp.tool.apkextractor/                             22-Feb-2021 12:18                   -
bander.notepad/                                    22-Feb-2021 12:18                   -
be.ac.ulb.lisa.idot.android.dicomviewer/           22-Feb-2021 12:18                   -
be.brunoparmentier.apkshare/                       22-Feb-2021 12:18                   -
be.brunoparmentier.dnssetter/                      22-Feb-2021 12:18                   -
be.brunoparmentier.openbikesharing.app/            22-Feb-2021 12:18                   -
be.brunoparmentier.wifikeyshare/                   22-Feb-2021 12:18                   -
be.digitalia.fosdem/                               22-Feb-2021 12:18                   -
be.lionslink.ucllstudent/                          22-Feb-2021 12:18                   -
be.mygod.vpnhotspot/                               22-Feb-2021 12:18                   -
be.norio.randomapp/                                22-Feb-2021 12:18                   -
be.ppareit.shutdown/                               22-Feb-2021 12:18                   -
be.ppareit.swiftp_free/                            22-Feb-2021 12:18                   -
be.quentinloos.manille/                            22-Feb-2021 12:18                   -
be.uhasselt.privacypolice/                         22-Feb-2021 12:18                   -
biz.codefuture.svgviewer/                          22-Feb-2021 12:18                   -
biz.gyrus.yaab/                                    22-Feb-2021 12:18                   -
br.com.frs.foodrestrictions/                       22-Feb-2021 12:18                   -
br.odb.knights/                                    22-Feb-2021 12:18                   -
br.usp.ime.retrobreaker/                           22-Feb-2021 12:18                   -
btools.routingapp/                                 22-Feb-2021 12:18                   -
budo.budoist/                                      22-Feb-2021 12:18                   -
buet.rafi.dictionary/                              22-Feb-2021 12:18                   -
bughunter2.smsfilter/                              22-Feb-2021 12:18                   -
bus.chio.wishmaster/                               22-Feb-2021 12:18                   -
byrne.utilities.converter/                         22-Feb-2021 12:18                   -
byrne.utilities.hashpass/                          22-Feb-2021 12:18                   -
byrne.utilities.pasteedroid/                       22-Feb-2021 12:18                   -
ca.cmetcalfe.locationshare/                        22-Feb-2021 12:18                   -
ca.cmetcalfe.xposed.disablebatterywarnings/        22-Feb-2021 12:18                   -
ca.cmetcalfe.xposed.flatconnectivityicons/         22-Feb-2021 12:18                   -
ca.ddaly.android.heart/                            22-Feb-2021 12:18                   -
ca.farrelltonsolar.classic/                        22-Feb-2021 12:18                   -
ca.mimic.apphangar/                                22-Feb-2021 12:18                   -
ca.mudar.fairphone.peaceofmind/                    22-Feb-2021 12:18                   -
ca.pr0ps.xposed.entrustunblocker/                  22-Feb-2021 12:18                   -
ca.rmen.android.frenchcalendar/                    22-Feb-2021 12:18                   -
ca.rmen.android.networkmonitor/                    22-Feb-2021 12:18                   -
ca.rmen.android.poetassistant/                     22-Feb-2021 12:18                   -
ca.rmen.android.scrumchatter/                      22-Feb-2021 12:18                   -
ca.rmen.nounours/                                  22-Feb-2021 12:18                   -
caldwell.ben.bites/                                22-Feb-2021 12:18                   -
caldwell.ben.trolly/                               22-Feb-2021 12:18                   -
campyre.android/                                   22-Feb-2021 12:18                   -
cat.jordihernandez.cinecat/                        22-Feb-2021 12:18                   -
cat.mvmike.minimalcalendarwidget/                  22-Feb-2021 12:18                   -
cat.pantsu.nyaapantsu/                             22-Feb-2021 12:18                   -
cc.calliope.mini/                                  22-Feb-2021 12:18                   -
cc.co.eurdev.urecorder/                            22-Feb-2021 12:18                   -
cc.echonet.coolmicapp/                             22-Feb-2021 12:18                   -
cc.rainwave.android/                               22-Feb-2021 12:18                   -
cgeo.geocaching/                                   22-Feb-2021 12:18                   -
ch.abertschi.adfree/                               22-Feb-2021 12:18                   -
ch.blinkenlights.android.apnswitch/                22-Feb-2021 12:18                   -
ch.blinkenlights.android.vanilla/                  22-Feb-2021 12:18                   -
ch.blinkenlights.android.vanillaplug/              22-Feb-2021 12:18                   -
ch.blinkenlights.battery/                          22-Feb-2021 12:18                   -
ch.citux.td/                                       22-Feb-2021 12:18                   -
ch.corten.aha.worldclock/                          22-Feb-2021 12:18                   -
ch.deletescape.lawnchair.plah/                     22-Feb-2021 12:18                   -
ch.dissem.android.drupal/                          22-Feb-2021 12:18                   -
ch.fixme.cowsay/                                   22-Feb-2021 12:18                   -
ch.fixme.status/                                   22-Feb-2021 12:18                   -
ch.gassenarbeit.bern.your.rights/                  22-Feb-2021 12:18                   -
ch.hgdev.toposuite/                                22-Feb-2021 12:18                   -
ch.hsr.eyecam/                                     22-Feb-2021 12:18                   -
ch.ihdg.calendarcolor/                             22-Feb-2021 12:18                   -
ch.jiikuy.velocitycalculator/                      22-Feb-2021 12:18                   -
ch.logixisland.anuto/                              22-Feb-2021 12:18                   -
ch.nexuscomputing.android.osciprimeics/            22-Feb-2021 12:18                   -
ch.protonvpn.android/                              22-Feb-2021 12:18                   -
ch.rmy.android.http_shortcuts/                     22-Feb-2021 12:18                   -
ch.rmy.android.statusbar_tacho/                    22-Feb-2021 12:18                   -
ch.rrelmy.android.batterymanager/                  22-Feb-2021 12:18                   -
ch.rrelmy.android.locationcachemap/                22-Feb-2021 12:18                   -
ch.thgoebel.spartathlonapp/                        22-Feb-2021 12:18                   -
chat.rocket.android/                               22-Feb-2021 12:18                   -
chromiumupdater.bamless.com.chromiumsweupdater/    22-Feb-2021 12:18                   -
cityfreqs.com.pilfershushjammer/                   22-Feb-2021 12:18                   -
cl.coders.faketraveler/                            22-Feb-2021 12:18                   -
click.dummer.UartSmartwatch/                       22-Feb-2021 12:18                   -
click.dummer.funphonepuppet/                       22-Feb-2021 12:18                   -
click.dummer.have_radiosion/                       22-Feb-2021 12:18                   -
click.dummer.imagesms/                             22-Feb-2021 12:18                   -
click.dummer.notify_to_jabber/                     22-Feb-2021 12:18                   -
click.dummer.rickapp/                              22-Feb-2021 12:18                   -
click.dummer.textthing/                            22-Feb-2021 12:18                   -
click.dummer.yidkey/                               22-Feb-2021 12:18                   -
co.epitre.aelf_lectures/                           22-Feb-2021 12:18                   -
co.garmax.materialflashlight/                      22-Feb-2021 12:18                   -
co.loubo.icicle/                                   22-Feb-2021 12:18                   -
co.pxhouse.sas/                                    22-Feb-2021 12:18                   -
com.Bisha.TI89EmuDonation/                         22-Feb-2021 12:18                   -
com.DartChecker/                                   22-Feb-2021 12:18                   -
com.EthanHeming.NeuralNetworkSimulator/            22-Feb-2021 12:18                   -
com.FireFart.Permissions2/                         22-Feb-2021 12:18                   -
com.GTP.eveminer/                                  22-Feb-2021 12:18                   -
com.MarcosDiez.shareviahttp/                       22-Feb-2021 12:18                   -
com.Pau.ImapNotes2/                                22-Feb-2021 12:18                   -
com.a5corp.weather/                                22-Feb-2021 12:18                   -
com.aa.mynotes/                                    22-Feb-2021 12:18                   -
com.aaronhalbert.nosurfforreddit/                  22-Feb-2021 12:18                   -
com.aaronjwood.portauthority/                      22-Feb-2021 12:18                   -
com.abast.homebot/                                 22-Feb-2021 12:18                   -
com.abcdjdj.rootverifier/                          22-Feb-2021 12:18                   -
com.abhijitvalluri.android.fitnotifications/       22-Feb-2021 12:18                   -
com.abitsinc.andr/                                 22-Feb-2021 12:18                   -
com.achep.acdisplay/                               22-Feb-2021 12:18                   -
com.achep.widget.jellyclock/                       22-Feb-2021 12:18                   -
com.actisec.clipcaster/                            22-Feb-2021 12:18                   -
com.acvarium.tasclock/                             22-Feb-2021 12:18                   -
com.adam.aslfms/                                   22-Feb-2021 12:18                   -
com.addi/                                          22-Feb-2021 12:18                   -
com.adguard.android.contentblocker/                22-Feb-2021 12:18                   -
com.adityakamble49.dcipher/                        22-Feb-2021 12:18                   -
com.adonai.manman/                                 22-Feb-2021 12:18                   -
com.adstrosoftware.launchappops/                   22-Feb-2021 12:18                   -
com.aefyr.sai.fdroid/                              22-Feb-2021 12:18                   -
com.afollestad.nocknock/                           22-Feb-2021 12:18                   -
com.agateau.catgenerator/                          22-Feb-2021 12:18                   -
com.agateau.tinywheels.android/                    22-Feb-2021 12:18                   -
com.agnibho.android.solarcompass/                  22-Feb-2021 12:18                   -
com.ahorcado/                                      22-Feb-2021 12:18                   -
com.aidinhut.simpletextcrypt/                      22-Feb-2021 12:18                   -
com.akop.bach/                                     22-Feb-2021 12:18                   -
com.alaskalinuxuser.criticalvelocity/              22-Feb-2021 12:18                   -
com.alaskalinuxuser.hourglass/                     22-Feb-2021 12:18                   -
com.alaskalinuxuser.justchess/                     22-Feb-2021 12:18                   -
com.alaskalinuxuser.justcraigslist/                22-Feb-2021 12:18                   -
com.alaskalinuxuser.justnotes/                     22-Feb-2021 12:18                   -
com.alaskalinuxuser.rilcontrol/                    22-Feb-2021 12:18                   -
com.alaskalinuxuser.shipcaptainandcrew/            22-Feb-2021 12:18                   -
com.alexcruz.papuhwalls/                           22-Feb-2021 12:18                   -
com.alexkang.bluechat/                             22-Feb-2021 12:18                   -
com.alexkang.loopboard/                            22-Feb-2021 12:18                   -
com.alexkang.x3matrixcalculator/                   22-Feb-2021 12:18                   -
com.alexxz.hawkingquotes/                          22-Feb-2021 12:18                   -
com.alfray.asqare/                                 22-Feb-2021 12:18                   -
com.alfray.timeriffic/                             22-Feb-2021 12:18                   -
com.allansimon.verbisteandroid/                    22-Feb-2021 12:18                   -
com.alxgnon.postwriter/                            22-Feb-2021 12:18                   -
com.amabyte.vtucslabmanual/                        22-Feb-2021 12:18                   -
com.amaze.filemanager/                             22-Feb-2021 12:18                   -
com.ames.books/                                    22-Feb-2021 12:18                   -
com.amphoras.tpthelper/                            22-Feb-2021 12:18                   -
com.ancantus.HYPNOTOAD/                            22-Feb-2021 12:18                   -
com.anddevw.getchromium/                           22-Feb-2021 12:18                   -
com.andreasgift.totalzero/                         22-Feb-2021 12:18                   -
com.andrew.apollo/                                 22-Feb-2021 12:18                   -
com.android.adbkeyboard/                           22-Feb-2021 12:18                   -
com.android.gpstest.osmdroid/                      22-Feb-2021 12:18                   -
com.android.keepass/                               22-Feb-2021 12:18                   -
com.android.launcher3/                             22-Feb-2021 12:18                   -
com.android.music/                                 22-Feb-2021 12:18                   -
com.android.quake/                                 22-Feb-2021 12:18                   -
com.android.shellms/                               22-Feb-2021 12:18                   -
com.android.talkback/                              22-Feb-2021 12:18                   -
com.android2.calculator3/                          22-Feb-2021 12:18                   -
com.androidemu.gba/                                22-Feb-2021 12:18                   -
com.androidemu.gbc/                                22-Feb-2021 12:18                   -
com.androidemu.nes/                                22-Feb-2021 12:18                   -
com.androidfromfrankfurt.workingtimealert/         22-Feb-2021 12:18                   -
com.androsz.electricsleepbeta/                     22-Feb-2021 12:18                   -
com.androzic/                                      22-Feb-2021 12:18                   -
com.andybotting.tramhunter/                        22-Feb-2021 12:18                   -
com.angryburg.uapp/                                22-Feb-2021 12:18                   -
com.angrydoughnuts.android.alarmclock/             22-Feb-2021 12:18                   -
com.anoopknr.pastebin/                             22-Feb-2021 12:18                   -
com.anoshenko.android.mahjongg/                    22-Feb-2021 12:18                   -
com.anthony.deepl.openl/                           22-Feb-2021 12:18                   -
com.antoniotari.reactiveampacheapp/                22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.SSH/              22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.afrikaans/        22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.basque/           22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.brazilian/        22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.catalan/          22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.danish/           22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.dutch/            22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.esperanto/        22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.french/           22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.french_xlarge/    22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.galician/         22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.georgian.fdroid/  22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.german/           22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.greek/            22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.hebrew/           22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.hungarian/        22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.icelandic/        22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.indonesian/       22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.italian/          22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.latvian/          22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.macedonian/       22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.malayalam/        22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.neo/              22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.norwegian/        22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.osspolish/        22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.ossturkish/       22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.pali/             22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.persian/          22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.portuguese/       22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.russian2/         22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.slovene/          22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.spain/            22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.swedish/          22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.tatar/            22-Feb-2021 12:18                   -
com.anysoftkeyboard.languagepack.ukrainian/        22-Feb-2021 12:18                   -
com.anysoftkeyboard.theme.classic_pc/              22-Feb-2021 12:18                   -
com.app.Zensuren/                                  22-Feb-2021 12:18                   -
com.app.missednotificationsreminder/               22-Feb-2021 12:18                   -
com.app2go.sudokufree/                             22-Feb-2021 12:18                   -
com.appengine.paranoid_android.lost/               22-Feb-2021 12:18                   -
com.apps.adrcotfas.goodtime/                       22-Feb-2021 12:18                   -
com.appspot.usbhidterminal/                        22-Feb-2021 12:18                   -
com.aptasystems.dicewarepasswordgenerator/         22-Feb-2021 12:18                   -
com.aragaer.jtt/                                   22-Feb-2021 12:18                   -
com.ariwilson.seismowallpaper/                     22-Feb-2021 12:18                   -
com.arnaud.metronome/                              22-Feb-2021 12:18                   -
com.artifex.mupdf.mini.app/                        22-Feb-2021 12:18                   -
com.artifex.mupdf.viewer.app/                      22-Feb-2021 12:18                   -
com.artifex.mupdfdemo/                             22-Feb-2021 12:18                   -
com.as.anagramsolver/                              22-Feb-2021 12:18                   -
com.aselalee.trainschedule/                        22-Feb-2021 12:18                   -
com.asksven.betterwifionoff/                       22-Feb-2021 12:18                   -
com.atelieryl.wonderdroid/                         22-Feb-2021 12:18                   -
com.ath0.rpn/                                      22-Feb-2021 12:18                   -
com.atop/                                          22-Feb-2021 12:18                   -
com.atr.tedit/                                     22-Feb-2021 12:18                   -
com.aurora.adroid/                                 22-Feb-2021 12:18                   -
com.aurora.corona/                                 22-Feb-2021 12:18                   -
com.aurora.store/                                  22-Feb-2021 12:18                   -
com.averi.worldscribe/                             22-Feb-2021 12:18                   -
com.b44t.messenger/                                22-Feb-2021 12:18                   -
com.banasiak.coinflip/                             22-Feb-2021 12:18                   -
com.banasiak.coinflipext.example/                  22-Feb-2021 12:18                   -
com.bd.gitlab/                                     22-Feb-2021 12:18                   -
com.bec3.mobilite/                                 22-Feb-2021 12:18                   -
com.beem.project.beem/                             22-Feb-2021 12:18                   -
com.benny.openlauncher/                            22-Feb-2021 12:18                   -
com.bernaferrari.changedetection/                  22-Feb-2021 12:18                   -
com.bernaferrari.sdkmonitor/                       22-Feb-2021 12:18                   -
com.better.alarm/                                  22-Feb-2021 12:18                   -
com.bigbluecup.android.launcher/                   22-Feb-2021 12:18                   -
com.biglybt.android.client/                        22-Feb-2021 12:18                   -
com.bijoysingh.quicknote/                          22-Feb-2021 12:18                   -
com.blanyal.remindly/                              22-Feb-2021 12:18                   -
com.bleyl.recurrence/                              22-Feb-2021 12:18                   -
com.blippex.app/                                   22-Feb-2021 12:18                   -
com.blntsoft.emailpopup/                           22-Feb-2021 12:18                   -
com.blogspot.tonyatkins.freespeech/                22-Feb-2021 12:18                   -
com.bmco.cratesiounofficial/                       22-Feb-2021 12:18                   -
com.bmpak.anagramsolver/                           22-Feb-2021 12:18                   -
com.boardgamegeek/                                 22-Feb-2021 12:18                   -
com.bobbyrne01.howfardoyouswim/                    22-Feb-2021 12:18                   -
com.boombuler.games.shift/                         22-Feb-2021 12:18                   -
com.boombuler.piraten.map/                         22-Feb-2021 12:18                   -
com.boombuler.widgets.contacts/                    22-Feb-2021 12:18                   -
com.borneq.heregpslocation/                        22-Feb-2021 12:18                   -
com.botbrew.basil/                                 22-Feb-2021 12:18                   -
com.bottleworks.dailymoney/                        22-Feb-2021 12:18                   -
com.boztalay.puppyframeuid/                        22-Feb-2021 12:18                   -
com.brackeys.ui/                                   22-Feb-2021 12:18                   -
com.brapeba.roaminginfo/                           22-Feb-2021 12:18                   -
com.brentpanther.bitcoincashwidget/                22-Feb-2021 12:18                   -
com.brentpanther.bitcoinwidget/                    22-Feb-2021 12:18                   -
com.brentpanther.ethereumwidget/                   22-Feb-2021 12:18                   -
com.brentpanther.litecoinwidget/                   22-Feb-2021 12:18                   -
com.bretternst.URLazy/                             22-Feb-2021 12:18                   -
com.brewcrewfoo.performance/                       22-Feb-2021 12:18                   -
com.bri1.soundbored/                               22-Feb-2021 12:18                   -
com.brianco.colorclock/                            22-Feb-2021 12:18                   -
com.briankhuu.nfcmessageboard/                     22-Feb-2021 12:18                   -
com.brillenheini.deepscratch.free/                 22-Feb-2021 12:18                   -
com.brockoli.android.hsdroid/                      22-Feb-2021 12:18                   -
com.brocktice.JustSit/                             22-Feb-2021 12:18                   -
com.brosmike.airpushdetector/                      22-Feb-2021 12:18                   -
com.brucelet.spacetrader/                          22-Feb-2021 12:18                   -
com.btcontract.wallet/                             22-Feb-2021 12:18                   -
com.btmura.android.reddit/                         22-Feb-2021 12:18                   -
com.bvalosek.cpuspy/                               22-Feb-2021 12:18                   -
com.bwx.bequick/                                   22-Feb-2021 12:18                   -
com.byagowi.persiancalendar/                       22-Feb-2021 12:18                   -
com.bytesforge.linkasanote/                        22-Feb-2021 12:18                   -
com.bytestemplar.tonedef/                          22-Feb-2021 12:18                   -
com.call.recorder/                                 22-Feb-2021 12:18                   -
com.callrecorder.android/                          22-Feb-2021 12:18                   -
com.casimirlab.simpleDeadlines/                    22-Feb-2021 12:18                   -
com.catchingnow.tinyclipboardmanager/              22-Feb-2021 12:18                   -
com.cause.commune/                                 22-Feb-2021 12:18                   -
com.cebesius.materialhash/                         22-Feb-2021 12:18                   -
com.cebesius.wifiautoforget/                       22-Feb-2021 12:18                   -
com.cepmuvakkit.times/                             22-Feb-2021 12:18                   -
com.cgogolin.library/                              22-Feb-2021 12:18                   -
com.chanapps.four.activity/                        22-Feb-2021 12:18                   -
com.chancehorizon.just24hoursplus/                 22-Feb-2021 12:18                   -
com.chessclock.android/                            22-Feb-2021 12:18                   -
com.chmod0.manpages/                               22-Feb-2021 12:18                   -
com.chrisheald.flexauth/                           22-Feb-2021 12:18                   -
com.ciarang.tallyphant/                            22-Feb-2021 12:18                   -
com.cityfreqs.littlesirecho/                       22-Feb-2021 12:18                   -
com.cityzen.cityzen/                               22-Feb-2021 12:18                   -
com.claha.showtimeremote/                          22-Feb-2021 12:18                   -
com.cleveroad.sample/                              22-Feb-2021 12:18                   -
com.coboltforge.dontmind.multivnc/                 22-Feb-2021 12:18                   -
com.code.android.vibevault/                        22-Feb-2021 12:18                   -
com.code61.deadpixel/                              22-Feb-2021 12:18                   -
com.codebutler.farebot/                            22-Feb-2021 12:18                   -
com.colinmcdonough.android.torch/                  22-Feb-2021 12:18                   -
com.color.colornamer/                              22-Feb-2021 12:18                   -
com.commit451.gitlab/                              22-Feb-2021 12:18                   -
com.commonslab.commonslab/                         22-Feb-2021 12:18                   -
com.commonsware.android.arXiv/                     22-Feb-2021 12:18                   -
com.concentricsky.android.khan/                    22-Feb-2021 12:18                   -
com.cookiegames.smartcookie/                       22-Feb-2021 12:18                   -
com.corner23.android.beautyclocklivewallpaper/     22-Feb-2021 12:18                   -
com.corona_info/                                   22-Feb-2021 12:18                   -
com.corphish.nightlight.generic/                   22-Feb-2021 12:18                   -
com.corvettecole.gotosleep/                        22-Feb-2021 12:18                   -
com.coste.syncorg/                                 22-Feb-2021 12:18                   -
com.cr5315.cfdc/                                   22-Feb-2021 12:18                   -
com.cradle.iitc_mobile/                            22-Feb-2021 12:18                   -
com.craigd.lmsmaterial.app/                        22-Feb-2021 12:18                   -
com.crazyhitty.chdev.ks.munch/                     22-Feb-2021 12:18                   -
com.csmarosi.wifiautoff/                           22-Feb-2021 12:18                   -
com.cyanogenmod.filemanager.ics/                   22-Feb-2021 12:18                   -
com.cybrosys.palmcalc/                             22-Feb-2021 12:18                   -
com.dacer.simplepomodoro/                          22-Feb-2021 12:18                   -
com.dalthed.tucan/                                 22-Feb-2021 12:18                   -
com.danefinlay.ttsutil/                            22-Feb-2021 12:18                   -
com.danhasting.radar/                              22-Feb-2021 12:18                   -
com.daniel.mobilepauker2/                          22-Feb-2021 12:18                   -
com.danielkim.soundrecorder/                       22-Feb-2021 12:18                   -
com.danielme.muspyforandroid/                      22-Feb-2021 12:18                   -
com.danvelazco.fbwrapper/                          22-Feb-2021 12:18                   -
com.darknessmap/                                   22-Feb-2021 12:18                   -
com.darshancomputing.BatteryIndicator/             22-Feb-2021 12:18                   -
com.darshancomputing.BatteryIndicatorPro/          22-Feb-2021 12:18                   -
com.daviancorp.android.mh4udatabase/               22-Feb-2021 12:18                   -
com.daviancorp.android.monsterhunter3udatabase/    22-Feb-2021 12:18                   -
com.davidshewitt.admincontrol/                     22-Feb-2021 12:18                   -
com.dconstructing.cooper/                          22-Feb-2021 12:18                   -
com.derek_s.hubble_gallery/                        22-Feb-2021 12:18                   -
com.dev.cromer.jason.cshelper/                     22-Feb-2021 12:18                   -
com.dev.xavier.tempusromanum/                      22-Feb-2021 12:18                   -
com.developfreedom.wordpowermadeeasy/              22-Feb-2021 12:18                   -
com.dfa.hubzilla_android/                          22-Feb-2021 12:18                   -
com.dftec.planetcon/                               22-Feb-2021 12:18                   -
com.dfzlv.gjjlt.caramelos/                         22-Feb-2021 12:18                   -
com.dgmltn.morphclock.app/                         22-Feb-2021 12:18                   -
com.digitalfishfun.openshift/                      22-Feb-2021 12:18                   -
com.dimension.tessercube/                          22-Feb-2021 12:18                   -
com.dimtion.shaarlier/                             22-Feb-2021 12:18                   -
com.dirkgassen.wator/                              22-Feb-2021 12:18                   -
com.dje.openwifinetworkremover/                    22-Feb-2021 12:18                   -
com.dkanada.chip/                                  22-Feb-2021 12:18                   -
com.dkanada.icecons/                               22-Feb-2021 12:18                   -
com.dkanada.openapk/                               22-Feb-2021 12:18                   -
com.dngames.mobilewebcam/                          22-Feb-2021 12:18                   -
com.dnielfe.manager/                               22-Feb-2021 12:18                   -
com.docd.purefm/                                   22-Feb-2021 12:18                   -
com.doomy.overflow/                                22-Feb-2021 12:18                   -
com.doomy.torch/                                   22-Feb-2021 12:18                   -
com.doplgangr.secrecy/                             22-Feb-2021 12:18                   -
com.dosse.airpods/                                 22-Feb-2021 12:18                   -
com.dosse.bwentrain.androidPlayer/                 22-Feb-2021 12:18                   -
com.dosse.chromiumautoupdater/                     22-Feb-2021 12:18                   -
com.dosse.speedtest/                               22-Feb-2021 12:18                   -
com.dougkeen.bart/                                 22-Feb-2021 12:18                   -
com.dozingcatsoftware.asciicam/                    22-Feb-2021 12:18                   -
com.dozingcatsoftware.bouncy/                      22-Feb-2021 12:18                   -
com.dozingcatsoftware.cameratimer/                 22-Feb-2021 12:18                   -
com.dozingcatsoftware.dodge/                       22-Feb-2021 12:18                   -
com.dozuki.ifixit/                                 22-Feb-2021 12:18                   -
com.dp.logcatapp/                                  22-Feb-2021 12:18                   -
com.dragons.aurora/                                22-Feb-2021 12:18                   -
com.dririan.RingyDingyDingy/                       22-Feb-2021 12:18                   -
com.drismo/                                        22-Feb-2021 12:18                   -
com.drodin.tuxrider/                               22-Feb-2021 12:18                   -
com.ds.avare/                                      22-Feb-2021 12:18                   -
com.duckduckgo.mobile.android/                     22-Feb-2021 12:18                   -
com.dwak.lastcall/                                 22-Feb-2021 12:18                   -
com.dwalkes.android.toggleheadset2/                22-Feb-2021 12:18                   -
com.dynamicg.homebuttonlauncher/                   22-Feb-2021 12:18                   -
com.dynamite.heaterrc/                             22-Feb-2021 12:18                   -
com.earthblood.tictactoe/                          22-Feb-2021 12:18                   -
com.easwareapps.baria/                             22-Feb-2021 12:18                   -
com.easwareapps.f2lflap2lock_adfree/               22-Feb-2021 12:18                   -
com.easwareapps.g2l/                               22-Feb-2021 12:18                   -
com.easwareapps.marbleone_ad_free/                 22-Feb-2021 12:18                   -
com.easwareapps.quoter/                            22-Feb-2021 12:18                   -
com.easwareapps.transparentwidget/                 22-Feb-2021 12:18                   -
com.easyfitness/                                   22-Feb-2021 12:18                   -
com.easytarget.micopi/                             22-Feb-2021 12:18                   -
com.ebaschiera.triplecamel/                        22-Feb-2021 12:18                   -
com.ecuamobi.deckwallet/                           22-Feb-2021 12:18                   -
com.edwardoyarzun.diccionario/                     22-Feb-2021 12:18                   -
com.ei.bmicalc/                                    22-Feb-2021 12:18                   -
com.eibriel.reddot/                                22-Feb-2021 12:18                   -
com.einmalfel.podlisten/                           22-Feb-2021 12:18                   -
com.elementarytoday.theia/                         22-Feb-2021 12:18                   -
com.eletac.tronwallet/                             22-Feb-2021 12:18                   -
com.eleybourn.bookcatalogue/                       22-Feb-2021 12:18                   -
com.elsdoerfer.android.autostarts/                 22-Feb-2021 12:18                   -
com.elsewhat.android.currentwallpaper/             22-Feb-2021 12:18                   -
com.emmaguy.cleanstatusbar/                        22-Feb-2021 12:18                   -
com.emmanuelmess.simpleaccounting/                 22-Feb-2021 12:18                   -
com.emmanuelmess.simplecleanup/                    22-Feb-2021 12:18                   -
com.endeepak.dotsnsquares/                         22-Feb-2021 12:18                   -
com.eneko.hexcolortimewallpaper/                   22-Feb-2021 12:18                   -
com.enjoyingfoss.feeel/                            22-Feb-2021 12:18                   -
com.enjoyingfoss.om/                               22-Feb-2021 12:18                   -
com.enrico.earthquake/                             22-Feb-2021 12:18                   -
com.enrico.earthquake.batterysimplysolid/          22-Feb-2021 12:18                   -
com.enrico.filemanager/                            22-Feb-2021 12:18                   -
com.enrico.sample/                                 22-Feb-2021 12:18                   -
com.eolwral.osmonitor/                             22-Feb-2021 12:18                   -
com.episode6.android.appalarm.pro/                 22-Feb-2021 12:18                   -
com.euedge.openaviationmap.android/                22-Feb-2021 12:18                   -
com.evancharlton.mileage/                          22-Feb-2021 12:18                   -
com.evenement.encapsulation/                       22-Feb-2021 12:18                   -
com.eventyay.attendee/                             22-Feb-2021 12:18                   -
com.eventyay.organizer/                            22-Feb-2021 12:18                   -
com.everysoft.autoanswer/                          22-Feb-2021 12:18                   -
com.example.android.maxpapers/                     22-Feb-2021 12:18                   -
com.example.android.monthcalendarwidget/           22-Feb-2021 12:18                   -
com.example.anycut/                                22-Feb-2021 12:18                   -
com.example.dozencalc/                             22-Feb-2021 12:18                   -
com.example.forgottenumbrella.cardboardmuseum/     22-Feb-2021 12:18                   -
com.example.harisont.librery/                      22-Feb-2021 12:18                   -
com.example.hochi.nextcompanion/                   22-Feb-2021 12:18                   -
com.example.ismael.downloadfilesweb/               22-Feb-2021 12:18                   -
com.example.muzei.muzeiapod/                       22-Feb-2021 12:18                   -
com.example.openpass/                              22-Feb-2021 12:18                   -
com.example.root.analyticaltranslator/             22-Feb-2021 12:18                   -
com.example.sshtry/                                22-Feb-2021 12:18                   -
com.example.tobiastrumm.freifunkautoconnect/       22-Feb-2021 12:18                   -
com.example.trigger/                               22-Feb-2021 12:18                   -
com.f.coin/                                        22-Feb-2021 12:18                   -
com.f0x.eddymalou/                                 22-Feb-2021 12:18                   -
com.f2prateek.dfg/                                 22-Feb-2021 12:18                   -
com.fabienli.dokuwiki/                             22-Feb-2021 12:18                   -
com.fake.android.torchlight/                       22-Feb-2021 12:18                   -
com.falconware.prestissimo/                        22-Feb-2021 12:18                   -
com.farmerbb.notepad/                              22-Feb-2021 12:18                   -
com.farmerbb.secondscreen.free/                    22-Feb-2021 12:18                   -
com.farmerbb.taskbar/                              22-Feb-2021 12:18                   -
com.fastaccess.github.libre/                       22-Feb-2021 12:18                   -
com.fastebro.androidrgbtool/                       22-Feb-2021 12:18                   -
com.fgrim.msnake/                                  22-Feb-2021 12:18                   -
com.fisheradelakin.interactivestory/               22-Feb-2021 12:18                   -
com.fisheradelakin.vortex/                         22-Feb-2021 12:18                   -
com.fivasim.antikythera/                           22-Feb-2021 12:18                   -
com.flipcamera/                                    22-Feb-2021 12:18                   -
com.flxrs.dankchat/                                22-Feb-2021 12:18                   -
com.foobnix.pro.pdf.reader/                        22-Feb-2021 12:18                   -
com.formfun/                                       22-Feb-2021 12:18                   -
com.forum.fiend.osp/                               22-Feb-2021 12:18                   -
com.foxykeep.lifecounter/                          22-Feb-2021 12:18                   -
com.fproject.cryptolitycs/                         22-Feb-2021 12:18                   -
com.fr3ts0n.ecu.gui.androbd/                       22-Feb-2021 12:18                   -
com.fr3ts0n.stagefever/                            22-Feb-2021 12:18                   -
com.frankcalise.h2droid/                           22-Feb-2021 12:18                   -
com.freerdp.afreerdp/                              22-Feb-2021 12:18                   -
com.freezingwind.animereleasenotifier/             22-Feb-2021 12:18                   -
com.freshollie.monkeyboard.keystoneradio/          22-Feb-2021 12:18                   -
com.frostwire.android/                             22-Feb-2021 12:18                   -
com.frozendevs.cache.cleaner/                      22-Feb-2021 12:18                   -
com.frozendevs.periodictable/                      22-Feb-2021 12:18                   -
com.frrahat.quransimple/                           22-Feb-2021 12:18                   -
com.fsck.k9/                                       22-Feb-2021 12:18                   -
com.fsck.k9.material/                              22-Feb-2021 12:18                   -
com.fullscreen/                                    22-Feb-2021 12:18                   -
com.fusionx.lightirc/                              22-Feb-2021 12:18                   -
com.futonredemption.mylocation/                    22-Feb-2021 12:18                   -
com.futurice.android.reservator/                   22-Feb-2021 12:18                   -
com.gabm.fancyplaces/                              22-Feb-2021 12:18                   -
com.gabm.screenrotationcontrol/                    22-Feb-2021 12:18                   -
com.gacode.relaunchx/                              22-Feb-2021 12:18                   -
com.games.boardgames.aeonsend/                     22-Feb-2021 12:18                   -
com.gcstar.scanner/                                22-Feb-2021 12:18                   -
com.gcstar.viewer/                                 22-Feb-2021 12:18                   -
com.geecko.QuickLyric/                             22-Feb-2021 12:18                   -
com.gelakinetic.mtgfam/                            22-Feb-2021 12:18                   -
com.genonbeta.TrebleShot/                          22-Feb-2021 12:18                   -
com.germainz.activityforcenewtask/                 22-Feb-2021 12:18                   -
com.gh4a/                                          22-Feb-2021 12:18                   -
com.ghisguth.sun/                                  22-Feb-2021 12:18                   -
com.ghostsq.commander/                             22-Feb-2021 12:18                   -
com.ghostsq.commander.https/                       22-Feb-2021 12:18                   -
com.ghostsq.commander.samba/                       22-Feb-2021 12:18                   -
com.ghostsq.commander.sftp/                        22-Feb-2021 12:18                   -
com.ghstudios.android.mhgendatabase/               22-Feb-2021 12:18                   -
com.gimranov.zandy.app/                            22-Feb-2021 12:18                   -
com.ginkel.hashit/                                 22-Feb-2021 12:18                   -
com.gitea.theoden8.sudaku/                         22-Feb-2021 12:18                   -
com.github.aba2l.taswast/                          22-Feb-2021 12:18                   -
com.github.alijc.cricketsalarm/                    22-Feb-2021 12:18                   -
com.github.andlyticsproject/                       22-Feb-2021 12:18                   -
com.github.andremiras.etheroll/                    22-Feb-2021 12:18                   -
com.github.andremiras.qrscan/                      22-Feb-2021 12:18                   -
com.github.ashutoshgngwr.tenbitclockwidget/        22-Feb-2021 12:18                   -
com.github.axet.audiorecorder/                     22-Feb-2021 12:18                   -
com.github.axet.binauralbeats/                     22-Feb-2021 12:18                   -
com.github.axet.bookreader/                        22-Feb-2021 12:18                   -
com.github.axet.callrecorder/                      22-Feb-2021 12:18                   -
com.github.axet.darknessimmunity/                  22-Feb-2021 12:18                   -
com.github.axet.filemanager/                       22-Feb-2021 12:18                   -
com.github.axet.hourlyreminder/                    22-Feb-2021 12:18                   -
com.github.axet.maps/                              22-Feb-2021 12:18                   -
com.github.axet.mover/                             22-Feb-2021 12:18                   -
com.github.axet.smsgate/                           22-Feb-2021 12:18                   -
com.github.axet.tonegenerator/                     22-Feb-2021 12:18                   -
com.github.axet.torrentclient/                     22-Feb-2021 12:18                   -
com.github.catfriend1.syncthingandroid/            22-Feb-2021 12:18                   -
com.github.cetoolbox/                              22-Feb-2021 12:18                   -
com.github.cythara/                                22-Feb-2021 12:18                   -
com.github.darthjoey91.hangman/                    22-Feb-2021 12:18                   -
com.github.dawidd6.andttt/                         22-Feb-2021 12:18                   -
com.github.egonw.isotopes/                         22-Feb-2021 12:18                   -
com.github.gianlucanitti.expreval/                 22-Feb-2021 12:18                   -
com.github.gotify/                                 22-Feb-2021 12:18                   -
com.github.grimpy.botifier/                        22-Feb-2021 12:18                   -
com.github.gschwind.fiddle_assistant/              22-Feb-2021 12:18                   -
com.github.jtjj222.sudburytransit/                 22-Feb-2021 12:18                   -
com.github.kiliakin.yalpstore/                     22-Feb-2021 12:18                   -
com.github.marmalade.aRevelation/                  22-Feb-2021 12:18                   -
com.github.mobile/                                 22-Feb-2021 12:18                   -
com.github.mofosyne.instantreadme/                 22-Feb-2021 12:18                   -
com.github.mofosyne.tagdrop/                       22-Feb-2021 12:18                   -
com.github.moko256.twitlatte/                      22-Feb-2021 12:18                   -
com.github.nicolassmith.urlevaluator/              22-Feb-2021 12:18                   -
com.github.niqdev.ipcam/                           22-Feb-2021 12:18                   -
com.github.nutomic.controldlna/                    22-Feb-2021 12:18                   -
com.github.onetimepass/                            22-Feb-2021 12:18                   -
com.github.ooz.heymeditation/                      22-Feb-2021 12:18                   -
com.github.palmcalc2019.palmcalc/                  22-Feb-2021 12:18                   -
com.github.pires.obd.reader/                       22-Feb-2021 12:18                   -
com.github.pockethub.android/                      22-Feb-2021 12:18                   -
com.github.premnirmal.tickerwidget/                22-Feb-2021 12:18                   -
com.github.quarck.calnotify/                       22-Feb-2021 12:18                   -
com.github.redpanal.android/                       22-Feb-2021 12:18                   -
com.github.ruleant.getback_gps/                    22-Feb-2021 12:18                   -
com.github.samotari.cryptoterminal/                22-Feb-2021 12:18                   -
com.github.sryze.wirebug/                          22-Feb-2021 12:18                   -
com.github.timnew.smartremotecontrol/              22-Feb-2021 12:18                   -
com.github.wakhub.tinyclock/                       22-Feb-2021 12:18                   -
com.github.wdkapps.fillup/                         22-Feb-2021 12:18                   -
com.github.xloem.qrstream/                         22-Feb-2021 12:18                   -
com.github.yeriomin.dumbphoneassistant/            22-Feb-2021 12:18                   -
com.github.yeriomin.smsscheduler/                  22-Feb-2021 12:18                   -
com.github.yeriomin.workoutlog/                    22-Feb-2021 12:18                   -
com.github.yeriomin.yalpstore/                     22-Feb-2021 12:18                   -
com.gitlab.kreikenbaum.suntime.fdroid/             22-Feb-2021 12:18                   -
com.gk.simpleworkoutjournal/                       22-Feb-2021 12:18                   -
com.glTron/                                        22-Feb-2021 12:18                   -
com.gladis.tictactoe/                              22-Feb-2021 12:18                   -
com.glanznig.beepme/                               22-Feb-2021 12:18                   -
com.gluegadget.hndroid/                            22-Feb-2021 12:18                   -
com.gmail.afonsotrepa.pocketgopher/                22-Feb-2021 12:18                   -
com.gmail.altakey.effy/                            22-Feb-2021 12:18                   -
com.gmail.charleszq/                               22-Feb-2021 12:18                   -
com.gmail.jerickson314.sdscanner/                  22-Feb-2021 12:18                   -
com.gmail.jiwopene.temperature/                    22-Feb-2021 12:18                   -
com.gmail.mugcuposup.android/                      22-Feb-2021 12:18                   -
com.gmail.walles.johan.batterylogger/              22-Feb-2021 12:18                   -
com.gokhanmoral.stweaks.app/                       22-Feb-2021 12:18                   -
com.goltzkiste.guessaday/                          22-Feb-2021 12:18                   -
com.googamaphone.typeandspeak/                     22-Feb-2021 12:18                   -
com.google.android.accessibility.talkback/         22-Feb-2021 12:18                   -
com.google.android.apps.authenticator2/            22-Feb-2021 12:18                   -
com.google.android.diskusage/                      22-Feb-2021 12:18                   -
com.google.android.gms/                            22-Feb-2021 12:18                   -
com.google.android.location/                       22-Feb-2021 12:18                   -
com.google.android.marvin.talkback/                22-Feb-2021 12:18                   -
com.google.android.sambadocumentsprovider/         22-Feb-2021 12:18                   -
com.google.android.stardroid/                      22-Feb-2021 12:18                   -
com.google.code.apps2org/                          22-Feb-2021 12:18                   -
com.google.code.appsorganizer/                     22-Feb-2021 12:18                   -
com.google.code.geobeagle/                         22-Feb-2021 12:18                   -
com.google.marvin.shell/                           22-Feb-2021 12:18                   -
com.google.zxing.client.android/                   22-Feb-2021 12:18                   -
com.googlecode.android_scripting/                  22-Feb-2021 12:18                   -
com.googlecode.awsms/                              22-Feb-2021 12:18                   -
com.googlecode.chartdroid/                         22-Feb-2021 12:18                   -
com.googlecode.droidwall/                          22-Feb-2021 12:18                   -
com.googlecode.eyesfree.espeak/                    22-Feb-2021 12:18                   -
com.googlecode.gogodroid/                          22-Feb-2021 12:18                   -
com.googlecode.gtalksms/                           22-Feb-2021 12:18                   -
com.googlecode.networklog/                         22-Feb-2021 12:18                   -
com.googlecode.openwnn.legacy/                     22-Feb-2021 12:18                   -
com.googlecode.tcime/                              22-Feb-2021 12:18                   -
com.governikus.ausweisapp2/                        22-Feb-2021 12:18                   -
com.gpl.rpg.AndorsTrail/                           22-Feb-2021 12:18                   -
com.gpstether/                                     22-Feb-2021 12:18                   -
com.gracecode.android.presentation/                22-Feb-2021 12:18                   -
com.greenaddress.abcore/                           22-Feb-2021 12:18                   -
com.greenaddress.greenbits_android_wallet/         22-Feb-2021 12:18                   -
com.greenaddress.greenbits_android_wallet.testnet/ 22-Feb-2021 12:18                   -
com.gregorywlodarek.torontotransit.torontotransit/ 22-Feb-2021 12:18                   -
com.grocerymanager/                                22-Feb-2021 12:18                   -
com.gs.mobileprint/                                22-Feb-2021 12:18                   -
com.gsnathan.pdfviewer/                            22-Feb-2021 12:18                   -
com.gtp.showapicturetoyourfriend/                  22-Feb-2021 12:18                   -
com.gueei.applocker/                               22-Feb-2021 12:18                   -
com.gulshansingh.hackerlivewallpaper/              22-Feb-2021 12:18                   -
com.gunshippenguin.openflood/                      22-Feb-2021 12:18                   -
com.guvery.notifyme/                               22-Feb-2021 12:18                   -
com.haha01haha01.harail/                           22-Feb-2021 12:18                   -
com.halftough.webcomreader/                        22-Feb-2021 12:18                   -
com.harasoft.relaunch/                             22-Feb-2021 12:18                   -
com.haringeymobile.ukweather/                      22-Feb-2021 12:18                   -
com.harleensahni.android.mbr/                      22-Feb-2021 12:18                   -
com.hasi.hasid00r/                                 22-Feb-2021 12:18                   -
com.health.openscale/                              22-Feb-2021 12:18                   -
com.hectorone.multismssender/                      22-Feb-2021 12:18                   -
com.hermit.btreprap/                               22-Feb-2021 12:18                   -
com.hexad.bluezime/                                22-Feb-2021 12:18                   -
com.hexad.bluezime.hidenabler/                     22-Feb-2021 12:18                   -
com.hlidskialf.android.pomodoro/                   22-Feb-2021 12:18                   -
com.hobbyone.HashDroid/                            22-Feb-2021 12:18                   -
com.holokenmod/                                    22-Feb-2021 12:18                   -
com.howeyc.spiped/                                 22-Feb-2021 12:18                   -
com.htruong.inputmethod.latin/                     22-Feb-2021 12:18                   -
com.hykwok.CurrencyConverter/                      22-Feb-2021 12:18                   -
com.hyperionics.fbreader.plugin.tts_plus/          22-Feb-2021 12:18                   -
com.iamtrk.androidexplorer/                        22-Feb-2021 12:18                   -
com.iatfei.streakalarm/                            22-Feb-2021 12:18                   -
com.iazasoft.footguy/                              22-Feb-2021 12:18                   -
com.iboalali.sysnotifsnooze/                       22-Feb-2021 12:18                   -
com.ibrahimyousre.resumebuilder/                   22-Feb-2021 12:18                   -
com.icechen1.notable.pro/                          22-Feb-2021 12:18                   -
com.icecondor.nest/                                22-Feb-2021 12:18                   -
com.ichi2.anki/                                    22-Feb-2021 12:18                   -
com.idunnololz.igo/                                22-Feb-2021 12:18                   -
com.igisw.openmoneybox/                            22-Feb-2021 12:18                   -
com.igormaznitsa.piratedice/                       22-Feb-2021 12:18                   -
com.ihunda.android.binauralbeat/                   22-Feb-2021 12:18                   -
com.ilm.sandwich/                                  22-Feb-2021 12:18                   -
com.indieweb.indigenous/                           22-Feb-2021 12:18                   -
com.infonuascape.osrshelper/                       22-Feb-2021 12:18                   -
com.innodroid.mongobrowser/                        22-Feb-2021 12:18                   -
com.integralblue.callerid/                         22-Feb-2021 12:18                   -
com.internalpositioning.find3.find3app/            22-Feb-2021 12:18                   -
com.intervigil.micdroid/                           22-Feb-2021 12:18                   -
com.intrications.android.sharebrowser/             22-Feb-2021 12:18                   -
com.invano.ambientweather/                         22-Feb-2021 12:18                   -
com.irahul.worldclock/                             22-Feb-2021 12:18                   -
com.isaacparker.dozesettingseditor/                22-Feb-2021 12:18                   -
com.isanexusdev.androidcpg/                        22-Feb-2021 12:18                   -
com.isdp.trirose/                                  22-Feb-2021 12:18                   -
com.iskrembilen.quasseldroid/                      22-Feb-2021 12:18                   -
com.itds.sms.ping/                                 22-Feb-2021 12:18                   -
com.ivanvolosyuk.sharetobrowser/                   22-Feb-2021 12:18                   -
com.iven.musicplayergo/                            22-Feb-2021 12:18                   -
com.iven.xdafeedreader/                            22-Feb-2021 12:18                   -
com.jackpf.apkdownloader/                          22-Feb-2021 12:18                   -
com.jadn.cc/                                       22-Feb-2021 12:18                   -
com.jakebasile.android.hearingsaver/               22-Feb-2021 12:18                   -
com.jakewharton.sdksearch/                         22-Feb-2021 12:18                   -
com.jakewharton.telecine/                          22-Feb-2021 12:18                   -
com.james.status/                                  22-Feb-2021 12:18                   -
com.jarsilio.android.drowser/                      22-Feb-2021 12:18                   -
com.jarsilio.android.pocketup/                     22-Feb-2021 12:18                   -
com.java.SmokeReducer/                             22-Feb-2021 12:18                   -
com.javierllorente.adc/                            22-Feb-2021 12:18                   -
com.javiersantos.mlmanager/                        22-Feb-2021 12:18                   -
com.javiersantos.whatsappbetaupdater/              22-Feb-2021 12:18                   -
com.jaygoel.virginminuteschecker/                  22-Feb-2021 12:18                   -
com.jbirdvegas.mgerrit/                            22-Feb-2021 12:18                   -
com.jecelyin.editor/                               22-Feb-2021 12:18                   -
com.jeffboody.GearsES2eclair/                      22-Feb-2021 12:18                   -
com.jelly.theme.revenge/                           22-Feb-2021 12:18                   -
com.jereksel.libresubstratum/                      22-Feb-2021 12:18                   -
com.jeyries.quake2/                                22-Feb-2021 12:18                   -
com.jforce.chapelhillnextbus/                      22-Feb-2021 12:18                   -
com.jim.sharetocomputer/                           22-Feb-2021 12:18                   -
com.jkcarino.ankieditor/                           22-Feb-2021 12:18                   -
com.jlyr/                                          22-Feb-2021 12:18                   -
com.jmartin.temaki/                                22-Feb-2021 12:18                   -
com.jmartin.writeily/                              22-Feb-2021 12:18                   -
com.jmstudios.chibe/                               22-Feb-2021 12:18                   -
com.jmstudios.pointandhit.android/                 22-Feb-2021 12:18                   -
com.johan.vertretungsplan/                         22-Feb-2021 12:18                   -
com.jonbanjo.cupsprintservice/                     22-Feb-2021 12:18                   -
com.jonglen7.jugglinglab/                          22-Feb-2021 12:18                   -
com.jorgecastillo.kanadrill/                       22-Feb-2021 12:18                   -
com.joshtwigg.cmus.droid/                          22-Feb-2021 12:18                   -
com.jotabout.screeninfo/                           22-Feb-2021 12:18                   -
com.jparkie.aizoban/                               22-Feb-2021 12:18                   -
com.jpwolfso.privdnsqt/                            22-Feb-2021 12:18                   -
com.jstappdev.dbclf/                               22-Feb-2021 12:18                   -
com.jtechme.jumpgo/                                22-Feb-2021 12:18                   -
com.jtmcn.archwiki.viewer/                         22-Feb-2021 12:18                   -
com.juet.attendance/                               22-Feb-2021 12:18                   -
com.juliansparber.captiveportallogin/              22-Feb-2021 12:18                   -
com.junjunguo.pocketmaps/                          22-Feb-2021 12:18                   -
com.jvillalba.apod.classic/                        22-Feb-2021 12:18                   -
com.jvillalba.apod.md/                             22-Feb-2021 12:18                   -
com.jwetherell.heart_rate_monitor/                 22-Feb-2021 12:18                   -
com.kabouzeid.gramophone/                          22-Feb-2021 12:18                   -
com.kaeruct.glxy/                                  22-Feb-2021 12:18                   -
com.kai1973i/                                      22-Feb-2021 12:18                   -
com.kaliturin.blacklist/                           22-Feb-2021 12:18                   -
com.kanedias.holywarsoo/                           22-Feb-2021 12:18                   -
com.kanedias.vanilla.audiotag/                     22-Feb-2021 12:18                   -
com.kanedias.vanilla.coverfetch/                   22-Feb-2021 12:18                   -
com.kanedias.vanilla.lyrics/                       22-Feb-2021 12:18                   -
com.kanedias.vanilla.metadata/                     22-Feb-2021 12:18                   -
com.kaneoriley.cyanogenport.launcher3/             22-Feb-2021 12:18                   -
com.kazufukurou.nanji/                             22-Feb-2021 12:18                   -
com.kennyc.open.imgur/                             22-Feb-2021 12:18                   -
com.kgurgul.cpuinfo/                               22-Feb-2021 12:18                   -
com.khuttun.notificationnotes/                     22-Feb-2021 12:18                   -
com.kibab.android.EncPassChanger/                  22-Feb-2021 12:18                   -
com.kkinder.charmap/                               22-Feb-2021 12:18                   -
com.kn.paper_foss_theme/                           22-Feb-2021 12:18                   -
com.knirirr.beecount/                              22-Feb-2021 12:18                   -
com.kodarkooperativet.notificationstopwatch/       22-Feb-2021 12:18                   -
com.kolloware.wechange/                            22-Feb-2021 12:18                   -
com.kostmo.wallpaper.spiral/                       22-Feb-2021 12:18                   -
com.koushikdutta.superuser/                        22-Feb-2021 12:18                   -
com.kpz.pomodorotasks.activity/                    22-Feb-2021 12:18                   -
com.kure.musicplayer/                              22-Feb-2021 12:18                   -
com.kvance.Nectroid/                               22-Feb-2021 12:18                   -
com.kyakujin.android.tagnotepad/                   22-Feb-2021 12:18                   -
com.launcher.silverfish/                           22-Feb-2021 12:18                   -
com.lavadip.miniVector/                            22-Feb-2021 12:18                   -
com.leafdigital.kanji.android/                     22-Feb-2021 12:18                   -
com.lecz.android.tiltmazes/                        22-Feb-2021 12:18                   -
com.leinardi.kitchentimer/                         22-Feb-2021 12:18                   -
com.leocardz.multitouch.test/                      22-Feb-2021 12:18                   -
com.leocardz.url.unshortener/                      22-Feb-2021 12:18                   -
com.lesspass.android/                              22-Feb-2021 12:18                   -
com.lgallardo.qbittorrentclient/                   22-Feb-2021 12:18                   -
com.lgallardo.qbittorrentclientpro/                22-Feb-2021 12:18                   -
com.liato.bankdroid/                               22-Feb-2021 12:18                   -
com.libopenmw.openmw/                              22-Feb-2021 12:18                   -
com.lightbox.android.camera/                       22-Feb-2021 12:18                   -
com.limbo.emu.main/                                22-Feb-2021 12:18                   -
com.lindevhard.android.raspfinder/                 22-Feb-2021 12:18                   -
com.linkomnia.android.Changjie/                    22-Feb-2021 12:18                   -
com.linuxcounter.lico_update_003/                  22-Feb-2021 12:18                   -
com.litmus.worldscope/                             22-Feb-2021 12:18                   -
com.littlebytesofpi.pylauncher/                    22-Feb-2021 12:18                   -
com.llamacorp.equate/                              22-Feb-2021 12:18                   -
com.lligainterm/                                   22-Feb-2021 12:18                   -
com.log28/                                         22-Feb-2021 12:18                   -
com.lonepulse.travisjr/                            22-Feb-2021 12:18                   -
com.lostrealm.lembretes/                           22-Feb-2021 12:18                   -
com.lucasdnd.bitclock16/                           22-Feb-2021 12:18                   -
com.lucasdnd.decimaltimeclockwidget/               22-Feb-2021 12:18                   -
com.lucasdnd.unixtimeclockwidget/                  22-Feb-2021 12:18                   -
com.luk.saucenao/                                  22-Feb-2021 12:18                   -
com.luk.timetable2/                                22-Feb-2021 12:18                   -
com.lukekorth.screennotifications/                 22-Feb-2021 12:18                   -
com.lun.chin.aicamera/                             22-Feb-2021 12:18                   -
com.lyonbros.turtl/                                22-Feb-2021 12:18                   -
com.m3sv.plainupnp/                                22-Feb-2021 12:18                   -
com.madgag.agit/                                   22-Feb-2021 12:18                   -
com.majeur.applicationsinfo/                       22-Feb-2021 12:18                   -
com.makeinfo.sudokugenerator/                      22-Feb-2021 12:18                   -
com.malek.alldebrid/                               22-Feb-2021 12:18                   -
com.manichord.mgit/                                22-Feb-2021 12:18                   -
com.manor.currentwidget/                           22-Feb-2021 12:18                   -
com.mantz_it.rfanalyzer/                           22-Feb-2021 12:18                   -
com.manuelmaly.hn/                                 22-Feb-2021 12:18                   -
com.marceljurtz.lifecounter/                       22-Feb-2021 12:18                   -
com.marcospoerl.simplypace/                        22-Feb-2021 12:18                   -
com.mareksebera.simpledilbert/                     22-Feb-2021 12:18                   -
com.mariogrip.octoprint/                           22-Feb-2021 12:18                   -
com.markusborg.test/                               22-Feb-2021 12:18                   -
com.markuspage.android.certtools/                  22-Feb-2021 12:18                   -
com.martinborjesson.o2xtouchlednotifications/      22-Feb-2021 12:18                   -
com.maskyn.fileeditorpro/                          22-Feb-2021 12:18                   -
com.matburt.mobileorg/                             22-Feb-2021 12:18                   -
com.matejdro.pebbledialer/                         22-Feb-2021 12:18                   -
com.materialos.cm.theme/                           22-Feb-2021 12:18                   -
com.mathi_amorim.emmanuel.metrictime/              22-Feb-2021 12:18                   -
com.matoski.adbm/                                  22-Feb-2021 12:18                   -
com.matt.outfield/                                 22-Feb-2021 12:18                   -
com.mattallen.dpixel/                              22-Feb-2021 12:18                   -
com.mattallen.loaned/                              22-Feb-2021 12:18                   -
com.matteopacini.katana/                           22-Feb-2021 12:18                   -
com.mattermost.mattermost/                         22-Feb-2021 12:18                   -
com.mattgmg.miracastwidget/                        22-Feb-2021 12:18                   -
com.mattieapps.roommates/                          22-Feb-2021 12:18                   -
com.max2idea.android.fwknop/                       22-Feb-2021 12:18                   -
com.maxfierke.sandwichroulette/                    22-Feb-2021 12:18                   -
com.maxfour.music/                                 22-Feb-2021 12:18                   -
com.maxistar.textpad/                              22-Feb-2021 12:18                   -
com.mde.potdroid/                                  22-Feb-2021 12:18                   -
com.mdroid/                                        22-Feb-2021 12:18                   -
com.mehmetakiftutuncu.eshotroid/                   22-Feb-2021 12:18                   -
com.mendhak.gpslogger/                             22-Feb-2021 12:18                   -
com.menny.android.anysoftkeyboard/                 22-Feb-2021 12:18                   -
com.menny.anysoftkeyboard.finnish/                 22-Feb-2021 12:18                   -
com.metallic.chiaki/                               22-Feb-2021 12:18                   -
com.metinkale.prayer/                              22-Feb-2021 12:18                   -
com.mfreitas.twister/                              22-Feb-2021 12:18                   -
com.mgaetan89.showsrage/                           22-Feb-2021 12:18                   -
com.michaldabski.filemanager/                      22-Feb-2021 12:18                   -
com.midisheetmusic/                                22-Feb-2021 12:18                   -
com.mikifus.padland/                               22-Feb-2021 12:18                   -
com.mill_e.twitterwrapper/                         22-Feb-2021 12:18                   -
com.miqote.angelplayerwp/                          22-Feb-2021 12:18                   -
com.miqote.brswp/                                  22-Feb-2021 12:18                   -
com.miqote.shanawp/                                22-Feb-2021 12:18                   -
com.mirasmithy.epochlauncher/                      22-Feb-2021 12:18                   -
com.mitzuli/                                       22-Feb-2021 12:18                   -
com.mkf.droidsat/                                  22-Feb-2021 12:18                   -
com.mkulesh.micromath.plus/                        22-Feb-2021 12:18                   -
com.mkulesh.onpc/                                  22-Feb-2021 12:18                   -
com.mmazzarolo.breathly/                           22-Feb-2021 12:18                   -
com.mobilepearls.sokoban/                          22-Feb-2021 12:18                   -
com.mobiperf/                                      22-Feb-2021 12:18                   -
com.mod.android.widget.fbcw/                       22-Feb-2021 12:18                   -
com.moez.QKSMS/                                    22-Feb-2021 12:18                   -
com.mohammadag.beamfile/                           22-Feb-2021 12:18                   -
com.monead.games.android.sequence/                 22-Feb-2021 12:18                   -
com.money.manager.ex/                              22-Feb-2021 12:18                   -
com.mookie.circo/                                  22-Feb-2021 12:18                   -
com.moonpi.swiftnotes/                             22-Feb-2021 12:18                   -
com.moonpi.tapunlock/                              22-Feb-2021 12:18                   -
com.morlunk.mountie/                               22-Feb-2021 12:18                   -
com.morlunk.mumbleclient/                          22-Feb-2021 12:18                   -
com.movim.movim/                                   22-Feb-2021 12:18                   -
com.mrbimc.selinux/                                22-Feb-2021 12:18                   -
com.mridang.cellinfo/                              22-Feb-2021 12:18                   -
com.mridang.speedo/                                22-Feb-2021 12:18                   -
com.mridang.throttle/                              22-Feb-2021 12:18                   -
com.mridang.wifiinfo/                              22-Feb-2021 12:18                   -
com.msapps.touchdetector/                          22-Feb-2021 12:18                   -
com.mschlauch.comfortreader/                       22-Feb-2021 12:18                   -
com.murrayc.galaxyzoo.app/                         22-Feb-2021 12:18                   -
com.mustafaali.sensorssandbox/                     22-Feb-2021 12:18                   -
com.mustupid.metronome/                            22-Feb-2021 12:18                   -
com.mustupid.pitch_pipe/                           22-Feb-2021 12:18                   -
com.mykola.lexinproject/                           22-Feb-2021 12:18                   -
com.myopicmobile.textwarrior.android/              22-Feb-2021 12:18                   -
com.nagopy.android.disablemanager2/                22-Feb-2021 12:18                   -
com.naman14.stools/                                22-Feb-2021 12:18                   -
com.namelessdev.mpdroid/                           22-Feb-2021 12:18                   -
com.namsor.api.samples.gendre/                     22-Feb-2021 12:18                   -
com.nanoconverter.zlab/                            22-Feb-2021 12:18                   -
com.nathanosman.chronosnap/                        22-Feb-2021 12:18                   -
com.nauj27.android.colorpicker/                    22-Feb-2021 12:18                   -
com.nbossard.packlist/                             22-Feb-2021 12:18                   -
com.nephi.getoffyourphone/                         22-Feb-2021 12:18                   -
com.nephoapp.anarxiv/                              22-Feb-2021 12:18                   -
com.nesswit.galbijjimsearcher/                     22-Feb-2021 12:18                   -
com.netthreads.android.noiz2/                      22-Feb-2021 12:18                   -
com.newsblur/                                      22-Feb-2021 12:18                   -
com.nexes.manager/                                 22-Feb-2021 12:18                   -
com.nextcloud.android.beta/                        22-Feb-2021 12:18                   -
com.nextcloud.client/                              22-Feb-2021 12:18                   -
com.nextcloudpasswords/                            22-Feb-2021 12:18                   -
com.nextgis.mobile/                                22-Feb-2021 12:18                   -
com.nhellfire.kerneladiutor/                       22-Feb-2021 12:18                   -
com.nicobrailo.pianoli/                            22-Feb-2021 12:18                   -
com.nicolasbrailo.vlcfreemote/                     22-Feb-2021 12:18                   -
com.nicue.onetwo/                                  22-Feb-2021 12:18                   -
com.nightshadelabs.anotherbrowser/                 22-Feb-2021 12:18                   -
com.nikhiljha.lobstersapp/                         22-Feb-2021 12:18                   -
com.nilhcem.frcndict/                              22-Feb-2021 12:18                   -
com.nilhcem.hostseditor/                           22-Feb-2021 12:18                   -
com.niparasc.papanikolis/                          22-Feb-2021 12:18                   -
com.nkanaev.comics/                                22-Feb-2021 12:18                   -
com.nltechno.dolidroidpro/                         22-Feb-2021 12:18                   -
com.nma.util.sdcardtrac/                           22-Feb-2021 12:18                   -
com.nolanlawson.apptracker/                        22-Feb-2021 12:18                   -
com.nolanlawson.chordreader/                       22-Feb-2021 12:18                   -
com.nolanlawson.jnameconverter/                    22-Feb-2021 12:18                   -
com.nolanlawson.keepscore/                         22-Feb-2021 12:18                   -
com.nolanlawson.logcat/                            22-Feb-2021 12:18                   -
com.nomadlabs.labcoat.deeplinks/                   22-Feb-2021 12:18                   -
com.nononsenseapps.feeder/                         22-Feb-2021 12:18                   -
com.nononsenseapps.notepad/                        22-Feb-2021 12:18                   -
com.noprestige.kanaquiz/                           22-Feb-2021 12:18                   -
com.noshufou.android.su/                           22-Feb-2021 12:18                   -
com.notecryptpro/                                  22-Feb-2021 12:18                   -
com.notriddle.budget/                              22-Feb-2021 12:18                   -
com.notriddle.null_launcer/                        22-Feb-2021 12:18                   -
com.nowsecure.android.vts/                         22-Feb-2021 12:18                   -
com.nucc.hackwinds/                                22-Feb-2021 12:18                   -
com.numguesser.tonio_rpchp.numberguesser/          22-Feb-2021 12:18                   -
com.numix.calculator/                              22-Feb-2021 12:18                   -
com.numix.icons_circle/                            22-Feb-2021 12:18                   -
com.nutomic.ensichat/                              22-Feb-2021 12:18                   -
com.nutomic.syncthingandroid/                      22-Feb-2021 12:18                   -
com.nutomic.zertman/                               22-Feb-2021 12:18                   -
com.oF2pks.adbungfu/                               22-Feb-2021 12:18                   -
com.oF2pks.applicationsinfo/                       22-Feb-2021 12:18                   -
com.oF2pks.chairlock/                              22-Feb-2021 12:18                   -
com.oF2pks.classyshark3xodus/                      22-Feb-2021 12:18                   -
com.oF2pks.kalturadeviceinfos/                     22-Feb-2021 12:18                   -
com.oF2pks.neolinker/                              22-Feb-2021 12:18                   -
com.oF2pks.netscope/                               22-Feb-2021 12:18                   -
com.oakley.fon/                                    22-Feb-2021 12:18                   -
com.oasisfeng.island.fdroid/                       22-Feb-2021 12:18                   -
com.ogsdroid/                                      22-Feb-2021 12:18                   -
com.olam/                                          22-Feb-2021 12:18                   -
com.omegavesko.holocounter/                        22-Feb-2021 12:18                   -
com.omegavesko.sutransplus/                        22-Feb-2021 12:18                   -
com.oml.recordtimedroid/                           22-Feb-2021 12:18                   -
com.onetwofivegames.kungfoobarracuda/              22-Feb-2021 12:18                   -
com.opendoorstudios.ds4droid/                      22-Feb-2021 12:18                   -
com.opentaxi.android/                              22-Feb-2021 12:18                   -
com.orgzly/                                        22-Feb-2021 12:18                   -
com.oriondev.moneywallet/                          22-Feb-2021 12:18                   -
com.orphan.amplayer/                               22-Feb-2021 12:18                   -
com.orpheusdroid.screenrecorder/                   22-Feb-2021 12:18                   -
com.orpheusdroid.sqliteviewer/                     22-Feb-2021 12:18                   -
com.osfans.trime/                                  22-Feb-2021 12:18                   -
com.outdoordevs.ellaism.wallet/                    22-Feb-2021 12:18                   -
com.owncloud.android/                              22-Feb-2021 12:18                   -
com.packetsender.android/                          22-Feb-2021 12:18                   -
com.palliser.nztides/                              22-Feb-2021 12:18                   -
com.panaceasupplies.android.games.toytrain/        22-Feb-2021 12:18                   -
com.paranoid.ParanoidWallpapers/                   22-Feb-2021 12:18                   -
com.passcard/                                      22-Feb-2021 12:18                   -
com.pavelsikun.runinbackgroundpermissionsetter/    22-Feb-2021 12:18                   -
com.pcinpact/                                      22-Feb-2021 12:18                   -
com.perflyst.twire/                                22-Feb-2021 12:18                   -
com.pheelicks.visualizer/                          22-Feb-2021 12:18                   -
com.phg.constellations/                            22-Feb-2021 12:18                   -
com.phikal.regex/                                  22-Feb-2021 12:18                   -
com.philliphsu.clock2/                             22-Feb-2021 12:18                   -
com.philolog.hoplitekeyboard/                      22-Feb-2021 12:18                   -
com.phpsysinfo/                                    22-Feb-2021 12:18                   -
com.physphil.android.unitconverterultimate/        22-Feb-2021 12:18                   -
com.pierceholdings.dontpause/                      22-Feb-2021 12:18                   -
com.pierreduchemin.punchlinebingo/                 22-Feb-2021 12:18                   -
com.pikselbit.wrongpinshutdown/                    22-Feb-2021 12:18                   -
com.pilockerstable/                                22-Feb-2021 12:18                   -
com.pilot51.voicenotify/                           22-Feb-2021 12:18                   -
com.pindroid/                                      22-Feb-2021 12:18                   -
com.piratebayfree/                                 22-Feb-2021 12:18                   -
com.piwi.stickeroid/                               22-Feb-2021 12:18                   -
com.pixiv.muzei.pixivsource/                       22-Feb-2021 12:18                   -
com.pjuu.otterdroid/                               22-Feb-2021 12:18                   -
com.platypus.SAnd/                                 22-Feb-2021 12:18                   -
com.platypus.dicer/                                22-Feb-2021 12:18                   -
com.pluscubed.matloglibre/                         22-Feb-2021 12:18                   -
com.plusonelabs.calendar/                          22-Feb-2021 12:18                   -
com.poinsart.votar/                                22-Feb-2021 12:18                   -
com.polipoid/                                      22-Feb-2021 12:18                   -
com.politedroid/                                   22-Feb-2021 12:18                   -
com.poloure.simplerss/                             22-Feb-2021 12:18                   -
com.poupa.vinylmusicplayer/                        22-Feb-2021 12:18                   -
com.powerje.nyan/                                  22-Feb-2021 12:18                   -
com.powerpoint45.lucidbrowser/                     22-Feb-2021 12:18                   -
com.prangesoftwaresolutions.audioanchor/           22-Feb-2021 12:18                   -
com.prhlt.aemus.Read4SpeechExperiments/            22-Feb-2021 12:18                   -
com.primavera.arduino.listener/                    22-Feb-2021 12:18                   -
com.primokorn.enhancement/                         22-Feb-2021 12:18                   -
com.proch.practicehub/                             22-Feb-2021 12:18                   -
com.procrastimax.birthdaybuddy/                    22-Feb-2021 12:18                   -
com.projectsexception.myapplist.open/              22-Feb-2021 12:18                   -
com.purplefoto.pfdock/                             22-Feb-2021 12:18                   -
com.qsp.player/                                    22-Feb-2021 12:18                   -
com.quaap.audiometer/                              22-Feb-2021 12:18                   -
com.quaap.computationaldemonology/                 22-Feb-2021 12:18                   -
com.quaap.dodatheexploda/                          22-Feb-2021 12:18                   -
com.quaap.phonefonefun/                            22-Feb-2021 12:18                   -
com.quaap.primary/                                 22-Feb-2021 12:18                   -
com.qubling.sidekick/                              22-Feb-2021 12:18                   -
com.quchen.flashcard/                              22-Feb-2021 12:18                   -
com.quran.labs.androidquran/                       22-Feb-2021 12:18                   -
com.radioreddit.android/                           22-Feb-2021 12:18                   -
com.radiostudent.radiostudentstream/               22-Feb-2021 12:18                   -
com.rareventure.gps2/                              22-Feb-2021 12:18                   -
com.rascarlo.adaptive.brightness.tile/             22-Feb-2021 12:18                   -
com.rastating.droidbeard/                          22-Feb-2021 12:18                   -
com.readystatesoftware.ghostlog/                   22-Feb-2021 12:18                   -
com.redblaster.hsl.main/                           22-Feb-2021 12:18                   -
com.reddyetwo.hashmypass.app/                      22-Feb-2021 12:18                   -
com.redirectapps.tvkill/                           22-Feb-2021 12:18                   -
com.refactech.driibo/                              22-Feb-2021 12:18                   -
com.rehanced.lunary/                               22-Feb-2021 12:18                   -
com.reicast.emulator/                              22-Feb-2021 12:18                   -
com.repay.android/                                 22-Feb-2021 12:18                   -
com.replica.replicaisland/                         22-Feb-2021 12:18                   -
com.rfo.basic/                                     22-Feb-2021 12:18                   -
com.rhiannonweb.android.migrainetracker/           22-Feb-2021 12:18                   -
com.ridgelineapps.resdicegame/                     22-Feb-2021 12:18                   -
com.rigid.birthdroid/                              22-Feb-2021 12:18                   -
com.ringdroid/                                     22-Feb-2021 12:18                   -
com.rj.pixelesque/                                 22-Feb-2021 12:18                   -
com.robert.maps/                                   22-Feb-2021 12:18                   -
com.rockbyte.arxiv/                                22-Feb-2021 12:18                   -
com.rogerbassonsrenart.paddletennis/               22-Feb-2021 12:18                   -
com.roguetemple.hydroid/                           22-Feb-2021 12:18                   -
com.roguetemple.hyperroid/                         22-Feb-2021 12:18                   -
com.rohit2810.spotit/                              22-Feb-2021 12:18                   -
com.roozen.SoundManagerv2/                         22-Feb-2021 12:18                   -
com.rubenroy.minimaltodo/                          22-Feb-2021 12:18                   -
com.rubenwardy.minetestmodmanager/                 22-Feb-2021 12:18                   -
com.ruesga.android.wallpapers.photophase/          22-Feb-2021 12:18                   -
com.sagar.screenshift2/                            22-Feb-2021 12:18                   -
com.saha.batchuninstaller/                         22-Feb-2021 12:18                   -
com.sahdeepsingh.Bop/                              22-Feb-2021 12:18                   -
com.saibotd.bitbeaker/                             22-Feb-2021 12:18                   -
com.sakthipriyan.cricscore/                        22-Feb-2021 12:18                   -
com.saladdressing.veterondo/                       22-Feb-2021 12:18                   -
com.sam.hex/                                       22-Feb-2021 12:18                   -
com.samarthdesai.repeatme/                         22-Feb-2021 12:18                   -
com.samebits.beacon.locator/                       22-Feb-2021 12:18                   -
com.samsandberg.mtafarebuster/                     22-Feb-2021 12:18                   -
com.samsung.srpol/                                 22-Feb-2021 12:18                   -
com.sandeel.bushidoblocks/                         22-Feb-2021 12:18                   -
com.sapientech.mediagoblin/                        22-Feb-2021 12:18                   -
com.sapos_aplastados.game.clash_of_balls/          22-Feb-2021 12:18                   -
com.scar45.aokp.co.webviewer/                      22-Feb-2021 12:18                   -
com.scottmain.android.searchlight/                 22-Feb-2021 12:18                   -
com.scraperclub.android/                           22-Feb-2021 12:18                   -
com.sduduzog.slimlauncher/                         22-Feb-2021 12:18                   -
com.seafile.seadroid2/                             22-Feb-2021 12:18                   -
com.seavenois.tetris/                              22-Feb-2021 12:18                   -
com.seawolfsanctuary.keepingtracks/                22-Feb-2021 12:18                   -
com.seb.SLWP/                                      22-Feb-2021 12:18                   -
com.seb.SLWPmaps/                                  22-Feb-2021 12:18                   -
com.secuso.privacyFriendlyCodeScanner/             22-Feb-2021 12:18                   -
com.secuso.torchlight2/                            22-Feb-2021 12:18                   -
com.selbie.wrek/                                   22-Feb-2021 12:18                   -
com.selesca.xkcdmuzei/                             22-Feb-2021 12:18                   -
com.sensirion.smartgadget/                         22-Feb-2021 12:18                   -
com.serone.desktoplabel/                           22-Feb-2021 12:18                   -
com.serwylo.lexica/                                22-Feb-2021 12:18                   -
com.serwylo.msjviewer/                             22-Feb-2021 12:18                   -
com.sevag.pitcha/                                  22-Feb-2021 12:18                   -
com.sevag.unrealtracker/                           22-Feb-2021 12:18                   -
com.sgr_b2.compass/                                22-Feb-2021 12:18                   -
com.shadcat.secdroid/                              22-Feb-2021 12:18                   -
com.shanewmiller.gorecompanion/                    22-Feb-2021 12:18                   -
com.shatteredpixel.shatteredpixeldungeon/          22-Feb-2021 12:18                   -
com.shkmishra.lyrically/                           22-Feb-2021 12:18                   -
com.showmehills/                                   22-Feb-2021 12:18                   -
com.shurik.droidzebra/                             22-Feb-2021 12:18                   -
com.sidzi.circleofmusic/                           22-Feb-2021 12:18                   -
com.sigmarelax.doitoscihub/                        22-Feb-2021 12:18                   -
com.sigseg.android.worldmap/                       22-Feb-2021 12:18                   -
com.silentlexx.instead/                            22-Feb-2021 12:18                   -
com.silverkeytech.android_rivers/                  22-Feb-2021 12:18                   -
com.simonramstedt.yoke/                            22-Feb-2021 12:18                   -
com.simpledecredwidget/                            22-Feb-2021 12:18                   -
com.simplemobiletools.filemanager.pro/             22-Feb-2021 12:18                   -
com.simplemobiletools.gallery.pro/                 22-Feb-2021 12:18                   -
com.sinpo.xnfc/                                    22-Feb-2021 12:18                   -
com.sismics.reader/                                22-Feb-2021 12:18                   -
com.slash.batterychargelimit/                      22-Feb-2021 12:18                   -
com.sli.juicymobile/                               22-Feb-2021 12:18                   -
com.sli.ohmcalc/                                   22-Feb-2021 12:18                   -
com.slothwerks.hearthstone.compendiumforhearths..> 22-Feb-2021 12:18                   -
com.smerty.ham/                                    22-Feb-2021 12:18                   -
com.smilla.greentooth/                             22-Feb-2021 12:18                   -
com.smithdtyler.prettygoodmusicplayer/             22-Feb-2021 12:18                   -
com.smithdtyler.prettygoodmusicplayer.launchermode 22-Feb-2021 12:18                   -
com.smorgasbork.hotdeath/                          22-Feb-2021 12:18                   -
com.snaheth.trulyrandom/                           22-Feb-2021 12:18                   -
com.sound.ampache/                                 22-Feb-2021 12:18                   -
com.sovworks.edslite/                              22-Feb-2021 12:18                   -
com.soyblue.bluesound/                             22-Feb-2021 12:18                   -
com.spazedog.mounts2sd/                            22-Feb-2021 12:18                   -
com.sputnik.wispr/                                 22-Feb-2021 12:18                   -
com.spydiko.rotationmanager_foss/                  22-Feb-2021 12:18                   -
com.ssaurel.clocklw/                               22-Feb-2021 12:18                   -
com.standardnotes/                                 22-Feb-2021 12:18                   -
com.stripe1.xmouse/                                22-Feb-2021 12:18                   -
com.studio332.flickit/                             22-Feb-2021 12:18                   -
com.studio332.flickit.android/                     22-Feb-2021 12:18                   -
com.stwalkerster.android.apps.strobelight/         22-Feb-2021 12:18                   -
com.styrkurapp.app/                                22-Feb-2021 12:18                   -
com.sunshine.makilite/                             22-Feb-2021 12:18                   -
com.sunyata.kindmind/                              22-Feb-2021 12:18                   -
com.suyashsrijan.forcedoze/                        22-Feb-2021 12:18                   -
com.sweetiepiggy.everylocale/                      22-Feb-2021 12:18                   -
com.swiss.tournament/                              22-Feb-2021 12:18                   -
com.tachibana.downloader/                          22-Feb-2021 12:18                   -
com.taiste.lainari_en/                             22-Feb-2021 12:18                   -
com.tananaev.calculator/                           22-Feb-2021 12:18                   -
com.tananaev.logcat/                               22-Feb-2021 12:18                   -
com.tasomaniac.dashclock.hackerspace.floss/        22-Feb-2021 12:18                   -
com.tastycactus.timesheet/                         22-Feb-2021 12:18                   -
com.teamdc.stephendiniz.autoaway/                  22-Feb-2021 12:18                   -
com.teleca.jamendo/                                22-Feb-2021 12:18                   -
com.templaro.opsiz.aka/                            22-Feb-2021 12:18                   -
com.ten15.diyfish/                                 22-Feb-2021 12:18                   -
com.termoneplus/                                   22-Feb-2021 12:18                   -
com.termux/                                        22-Feb-2021 12:18                   -
com.termux.api/                                    22-Feb-2021 12:18                   -
com.termux.boot/                                   22-Feb-2021 12:18                   -
com.termux.nix/                                    22-Feb-2021 12:18                   -
com.termux.styling/                                22-Feb-2021 12:18                   -
com.termux.tasker/                                 22-Feb-2021 12:18                   -
com.termux.widget/                                 22-Feb-2021 12:18                   -
com.termux.window/                                 22-Feb-2021 12:18                   -
com.textuality.lifesaver2/                         22-Feb-2021 12:18                   -
com.th.XenonWallpapers/                            22-Feb-2021 12:18                   -
com.thechiefmeat.freetusky/                        22-Feb-2021 12:18                   -
com.thefonz.ed_tool/                               22-Feb-2021 12:18                   -
com.thehoick.evergreenwishlist/                    22-Feb-2021 12:18                   -
com.theksmith.android.car_bus_interface/           22-Feb-2021 12:18                   -
com.thermatk.android.xf.fakegapps/                 22-Feb-2021 12:18                   -
com.theworld.help.cbtandroid/                      22-Feb-2021 12:18                   -
com.thibaudperso.sonycamera/                       22-Feb-2021 12:18                   -
com.thirtydegreesray.openhub/                      22-Feb-2021 12:18                   -
com.threedlite.livePolys/                          22-Feb-2021 12:18                   -
com.threedlite.urforms/                            22-Feb-2021 12:18                   -
com.threedlite.userhash.location/                  22-Feb-2021 12:18                   -
com.tht.k3pler/                                    22-Feb-2021 12:18                   -
com.tierep.notificationanalyser/                   22-Feb-2021 12:18                   -
com.timvdalen.gizmooi/                             22-Feb-2021 12:18                   -
com.tinkerlog.android.pongtime/                    22-Feb-2021 12:18                   -
com.tjm.crushr/                                    22-Feb-2021 12:18                   -
com.tjm.stripepaper/                               22-Feb-2021 12:18                   -
com.tkjelectronics.balanduino/                     22-Feb-2021 12:18                   -
com.tmarki.comicmaker/                             22-Feb-2021 12:18                   -
com.tmendes.birthdaydroid/                         22-Feb-2021 12:18                   -
com.tmendes.dadosd/                                22-Feb-2021 12:18                   -
com.tnc.android.graphite/                          22-Feb-2021 12:18                   -
com.tobiaskuban.android.monthcalendarwidgetfoss/   22-Feb-2021 12:18                   -
com.tobykurien.batteryfu/                          22-Feb-2021 12:18                   -
com.tobykurien.google_news/                        22-Feb-2021 12:18                   -
com.tobykurien.webapps/                            22-Feb-2021 12:18                   -
com.tobykurien.webmediashare/                      22-Feb-2021 12:18                   -
com.todobom.opennotescanner/                       22-Feb-2021 12:18                   -
com.tomaszmarzeion.notepad/                        22-Feb-2021 12:18                   -
com.tomatodev.timerdroid/                          22-Feb-2021 12:18                   -
com.tomer.alwayson/                                22-Feb-2021 12:18                   -
com.tomer.dbz.widget/                              22-Feb-2021 12:18                   -
com.tomer.draw/                                    22-Feb-2021 12:18                   -
com.tomer.poke.notifier/                           22-Feb-2021 12:18                   -
com.tomer.screenshotsharer/                        22-Feb-2021 12:18                   -
com.tortel.syslog/                                 22-Feb-2021 12:18                   -
com.tortuca.holoken/                               22-Feb-2021 12:18                   -
com.totsp.bookworm/                                22-Feb-2021 12:18                   -
com.totsp.crossword.shortyz/                       22-Feb-2021 12:18                   -
com.traffar.a24game/                               22-Feb-2021 12:18                   -
com.traffar.game_of_life/                          22-Feb-2021 12:18                   -
com.traffar.gomoku/                                22-Feb-2021 12:18                   -
com.traffar.oware/                                 22-Feb-2021 12:18                   -
com.traffar.pentago/                               22-Feb-2021 12:18                   -
com.tritop.androsense2/                            22-Feb-2021 12:18                   -
com.tttdevs.stncbookmarks/                         22-Feb-2021 12:18                   -
com.tum.yahtzee/                                   22-Feb-2021 12:18                   -
com.tunes.viewer/                                  22-Feb-2021 12:18                   -
com.tunjid.fingergestures/                         22-Feb-2021 12:18                   -
com.turtleplayerv2/                                22-Feb-2021 12:18                   -
com.twinone.locker/                                22-Feb-2021 12:18                   -
com.twistedplane.sealnote/                         22-Feb-2021 12:18                   -
com.twofours.surespot/                             22-Feb-2021 12:18                   -
com.twolinessoftware.android/                      22-Feb-2021 12:18                   -
com.twsitedapps.homemanager/                       22-Feb-2021 12:18                   -
com.u17od.upm/                                     22-Feb-2021 12:18                   -
com.uberspot.a2048/                                22-Feb-2021 12:18                   -
com.ulicae.cinelog/                                22-Feb-2021 12:18                   -
com.ultrafunk.network_info/                        22-Feb-2021 12:18                   -
com.umang.dashnotifier/                            22-Feb-2021 12:18                   -
com.unciv.app/                                     22-Feb-2021 12:18                   -
com.unleashyouradventure.swaccess/                 22-Feb-2021 12:18                   -
com.unwind.networkmonitor/                         22-Feb-2021 12:18                   -
com.unwrappedapps.android.wallpaper.creative/      22-Feb-2021 12:18                   -
com.uploadedlobster.PwdHash/                       22-Feb-2021 12:18                   -
com.uraroji.garage.android.mp3recvoice/            22-Feb-2021 12:18                   -
com.ushahidi.android.app/                          22-Feb-2021 12:18                   -
com.utazukin.ichaival/                             22-Feb-2021 12:18                   -
com.utyf.pmetro/                                   22-Feb-2021 12:18                   -
com.vackosar.searchbasedlauncher/                  22-Feb-2021 12:18                   -
com.valleytg.oasvn.android/                        22-Feb-2021 12:18                   -
com.vanderbie.heart_rate_monitor/                  22-Feb-2021 12:18                   -
com.veken0m.bitcoinium/                            22-Feb-2021 12:18                   -
com.veniosg.dir/                                   22-Feb-2021 12:18                   -
com.vgorcum.minedmonero/                           22-Feb-2021 12:18                   -
com.viper.simplert/                                22-Feb-2021 12:18                   -
com.vlath.beheexplorer/                            22-Feb-2021 12:18                   -
com.vlath.keyboard/                                22-Feb-2021 12:18                   -
com.vlille.checker/                                22-Feb-2021 12:18                   -
com.voidcode.diasporawebclient/                    22-Feb-2021 12:18                   -
com.volosyukivan/                                  22-Feb-2021 12:18                   -
com.vonglasow.michael.satstat/                     22-Feb-2021 12:18                   -
com.vsmartcard.acardemulator/                      22-Feb-2021 12:18                   -
com.vsmartcard.remotesmartcardreader.app/          22-Feb-2021 12:18                   -
com.vuze.android.remote/                           22-Feb-2021 12:18                   -
com.vwp.locdemo/                                   22-Feb-2021 12:18                   -
com.vwp.owmap/                                     22-Feb-2021 12:18                   -
com.vwp.owmini/                                    22-Feb-2021 12:18                   -
com.wabadaba.dziennik/                             22-Feb-2021 12:18                   -
com.waist.line/                                    22-Feb-2021 12:18                   -
com.wanderfar.expander/                            22-Feb-2021 12:18                   -
com.wangdaye.mysplash/                             22-Feb-2021 12:18                   -
com.wanghaus.remembeer/                            22-Feb-2021 12:18                   -
com.watabou.pixeldungeon/                          22-Feb-2021 12:18                   -
com.wbrenna.gtfsoffline/                           22-Feb-2021 12:18                   -
com.weatherlight.elloshare/                        22-Feb-2021 12:18                   -
com.weicheng.taipeiyoubikeoffline/                 22-Feb-2021 12:18                   -
com.wentam.defcol/                                 22-Feb-2021 12:18                   -
com.wesaphzt.privatelocation/                      22-Feb-2021 12:18                   -
com.weskenyon.bookmarkos/                          22-Feb-2021 12:18                   -
com.wikaba.ogapp/                                  22-Feb-2021 12:18                   -
com.wikijourney.wikijourney/                       22-Feb-2021 12:18                   -
com.willhauck.linconnectclient/                    22-Feb-2021 12:18                   -
com.willianveiga.countdowntimer/                   22-Feb-2021 12:18                   -
com.wireguard.android/                             22-Feb-2021 12:18                   -
com.wmstein.tourcount/                             22-Feb-2021 12:18                   -
com.wmstein.transektcount/                         22-Feb-2021 12:18                   -
com.woefe.shoppinglist/                            22-Feb-2021 12:18                   -
com.wolas.awesomewallpaper/                        22-Feb-2021 12:18                   -
com.wordpress.chislonchow.legacylauncher/          22-Feb-2021 12:18                   -
com.wordpress.sarfraznawaz.callerdetails/          22-Feb-2021 12:18                   -
com.workingagenda.democracydroid/                  22-Feb-2021 12:18                   -
com.workingagenda.devinettes/                      22-Feb-2021 12:18                   -
com.workingagenda.fissure/                         22-Feb-2021 12:18                   -
com.wownero.wownerujo/                             22-Feb-2021 12:18                   -
com.write.Quill/                                   22-Feb-2021 12:18                   -
com.wrmndfzzy.atomize/                             22-Feb-2021 12:18                   -
com.x1unix.s60icons/                               22-Feb-2021 12:18                   -
com.xabber.android/                                22-Feb-2021 12:18                   -
com.xabber.android.classic/                        22-Feb-2021 12:18                   -
com.xabber.androiddev/                             22-Feb-2021 12:18                   -
com.xargsgrep.portknocker/                         22-Feb-2021 12:18                   -
com.xatik.app.droiddraw.client/                    22-Feb-2021 12:18                   -
com.xda.theme.cyanogenmod/                         22-Feb-2021 12:18                   -
com.xenris.liquidwarsos/                           22-Feb-2021 12:18                   -
com.xlythe.calculator.material/                    22-Feb-2021 12:18                   -
com.xlythe.minecraftclock/                         22-Feb-2021 12:18                   -
com.xmission.trevin.android.todo/                  22-Feb-2021 12:18                   -
com.xperia64.timidityae/                           22-Feb-2021 12:18                   -
com.yasfa.views/                                   22-Feb-2021 12:18                   -
com.yassirh.digitalocean/                          22-Feb-2021 12:18                   -
com.yubico.yubiclip/                               22-Feb-2021 12:18                   -
com.yubico.yubioath/                               22-Feb-2021 12:18                   -
com.yubico.yubitotp/                               22-Feb-2021 12:18                   -
com.zachrattner.pockettalk/                        22-Feb-2021 12:18                   -
com.zagayevskiy.pacman/                            22-Feb-2021 12:18                   -
com.zapta.apps.maniana/                            22-Feb-2021 12:18                   -
com.zaren/                                         22-Feb-2021 12:18                   -
com.zeapo.pwdstore/                                22-Feb-2021 12:18                   -
com.zegoggles.smssync/                             22-Feb-2021 12:18                   -
com.zenstyle.muzei.wlppr/                          22-Feb-2021 12:18                   -
com.zoffcc.applications.aagtl/                     22-Feb-2021 12:18                   -
com.zoffcc.applications.zanavi/                    22-Feb-2021 12:18                   -
com.zola.bmi/                                      22-Feb-2021 12:18                   -
com.zorinos.zorin_connect/                         22-Feb-2021 12:18                   -
com.zzzmode.appopsx/                               22-Feb-2021 12:18                   -
community.fairphone.checkup/                       22-Feb-2021 12:18                   -
community.fairphone.mycontacts/                    22-Feb-2021 12:18                   -
community.peers.internetradio/                     22-Feb-2021 12:18                   -
community.peers.license/                           22-Feb-2021 12:18                   -
cos.premy.mines/                                   22-Feb-2021 12:18                   -
cri.sanity/                                        22-Feb-2021 12:18                   -
cs4295.memecreator/                                22-Feb-2021 12:18                   -
csci567.squeez/                                    22-Feb-2021 12:18                   -
csd.qtproject.minesweeper/                         22-Feb-2021 12:18                   -
csh.cryptonite/                                    22-Feb-2021 12:18                   -
cx.hell.android.pdfview/                           22-Feb-2021 12:18                   -
cx.hell.android.pdfviewpro/                        22-Feb-2021 12:18                   -
cx.mccormick.pddroidparty/                         22-Feb-2021 12:18                   -
cx.ring/                                           22-Feb-2021 12:18                   -
cxa.gridwallpaper/                                 22-Feb-2021 12:18                   -
cxa.lineswallpaper/                                22-Feb-2021 12:18                   -
cz.antecky.netswitch/                              22-Feb-2021 12:18                   -
cz.dvratil.fbeventsync/                            22-Feb-2021 12:18                   -
cz.eutopia.snooperstopper/                         22-Feb-2021 12:18                   -
cz.harvie.northdog/                                22-Feb-2021 12:18                   -
cz.hejl.chesswalk/                                 22-Feb-2021 12:18                   -
cz.jiriskorpil.amixerwebui/                        22-Feb-2021 12:18                   -
cz.jirkovsky.lukas.chmupocasi/                     22-Feb-2021 12:18                   -
cz.martykan.forecastie/                            22-Feb-2021 12:18                   -
cz.martykan.webtube/                               22-Feb-2021 12:18                   -
cz.nic.turris/                                     22-Feb-2021 12:18                   -
cz.romario.opensudoku/                             22-Feb-2021 12:18                   -
cz.vitSkalicky.klavesnice/                         22-Feb-2021 12:18                   -
d.d.meshenger/                                     22-Feb-2021 12:18                   -
damo.three.ie/                                     22-Feb-2021 12:18                   -
daniel_32.flexiblewallpaper/                       22-Feb-2021 12:18                   -
dasher.android/                                    22-Feb-2021 12:18                   -
de.Cherubin7th.blackscreenpresentationremote/      22-Feb-2021 12:18                   -
de.agrothe.go/                                     22-Feb-2021 12:18                   -
de.akaflieg_freiburg.enroute/                      22-Feb-2021 12:18                   -
de.antonarnold.android.xoverrideheadphonejackde..> 22-Feb-2021 12:18                   -
de.antonfluegge.android.yubnubwidgetadfree/        22-Feb-2021 12:18                   -
de.antonwolf.agendawidget/                         22-Feb-2021 12:18                   -
de.arnefeil.bewegungsmelder/                       22-Feb-2021 12:18                   -
de.arnowelzel.android.periodical/                  22-Feb-2021 12:18                   -
de.asmw.sudokunst/                                 22-Feb-2021 12:18                   -
de.audioattack.openlink/                           22-Feb-2021 12:18                   -
de.azapps.mirakel.dashclock/                       22-Feb-2021 12:18                   -
de.azapps.mirakelandroid/                          22-Feb-2021 12:18                   -
de.b0nk.fp1_epo_autoupdate/                        22-Feb-2021 12:18                   -
de.badaix.snapcast/                                22-Feb-2021 12:18                   -
de.bashtian.dashclocksunrise/                      22-Feb-2021 12:18                   -
de.baumann.browser/                                22-Feb-2021 12:18                   -
de.baumann.hhsmoodle/                              22-Feb-2021 12:18                   -
de.baumann.pdfcreator/                             22-Feb-2021 12:18                   -
de.baumann.quitsmoking/                            22-Feb-2021 12:18                   -
de.baumann.sieben/                                 22-Feb-2021 12:18                   -
de.baumann.thema/                                  22-Feb-2021 12:18                   -
de.baumann.weather/                                22-Feb-2021 12:18                   -
de.binary_kitchen.doorlock_app/                    22-Feb-2021 12:18                   -
de.bitsharesmunich.smartcoinswallet/               22-Feb-2021 12:18                   -
de.bitsharesmunich.wallet/                         22-Feb-2021 12:18                   -
de.bjusystems.vdrmanager/                          22-Feb-2021 12:18                   -
de.blau.android/                                   22-Feb-2021 12:18                   -
de.blinkt.openvpn/                                 22-Feb-2021 12:18                   -
de.blocklink.pigrid/                               22-Feb-2021 12:18                   -
de.boesling.hydromemo/                             22-Feb-2021 12:18                   -
de.c3nav.droid/                                    22-Feb-2021 12:18                   -
de.chaosdorf.meteroid/                             22-Feb-2021 12:18                   -
de.cketti.dashclock.k9/                            22-Feb-2021 12:18                   -
de.clemensbartz.android.launcher/                  22-Feb-2021 12:18                   -
de.cryptobitch.muelli.barcodegen/                  22-Feb-2021 12:18                   -
de.cryptobitch.muelli.vouchercalc/                 22-Feb-2021 12:18                   -
de.csicar.mensaplan/                               22-Feb-2021 12:18                   -
de.cwde.freeshisen/                                22-Feb-2021 12:18                   -
de.cweiske.headphoneindicator/                     22-Feb-2021 12:18                   -
de.danielweisser.android.ldapsync/                 22-Feb-2021 12:18                   -
de.democracydeutschland.app/                       22-Feb-2021 12:18                   -
de.devisnik.android.sliding/                       22-Feb-2021 12:18                   -
de.devmil.muzei.bingimageofthedayartsource/        22-Feb-2021 12:18                   -
de.devmil.paperlaunch/                             22-Feb-2021 12:18                   -
de.digisocken.anotherrss/                          22-Feb-2021 12:18                   -
de.digisocken.openwort/                            22-Feb-2021 12:18                   -
de.digisocken.reotwe/                              22-Feb-2021 12:18                   -
de.digisocken.stop_o_moto/                         22-Feb-2021 12:18                   -
de.dotwee.micropinner/                             22-Feb-2021 12:18                   -
de.drhoffmannsoft.pizza/                           22-Feb-2021 12:18                   -
de.drhoffmannsoftware.calcvac/                     22-Feb-2021 12:18                   -
de.drhoffmannsoftware.xearth/                      22-Feb-2021 12:18                   -
de.duenndns.gmdice/                                22-Feb-2021 12:18                   -
de.eidottermihi.raspicheck/                        22-Feb-2021 12:18                   -
de.enaikoon.android.keypadmapper3/                 22-Feb-2021 12:18                   -
de.feisar.wordvalue/                               22-Feb-2021 12:18                   -
de.fgerbig.spacepeng/                              22-Feb-2021 12:18                   -
de.fmaul.android.cmis/                             22-Feb-2021 12:18                   -
de.fragdenstaat.app/                               22-Feb-2021 12:18                   -
de.freewarepoint.whohasmystuff/                    22-Feb-2021 12:18                   -
de.freifunk_karte.freifunk_karte/                  22-Feb-2021 12:18                   -
de.fzi.bettyrieckmann.quotingstars/                22-Feb-2021 12:18                   -
de.gabbo.forro_lyrics/                             22-Feb-2021 12:18                   -
de.geeksfactory.opacclient/                        22-Feb-2021 12:18                   -
de.grobox.appbundlereporter/                       22-Feb-2021 12:18                   -
de.grobox.blitzmail/                               22-Feb-2021 12:18                   -
de.grobox.liberario/                               22-Feb-2021 12:18                   -
de.hampager.dapnetmobile/                          22-Feb-2021 12:18                   -
de.hechler.andfish/                                22-Feb-2021 12:18                   -
de.hfu.funfpunktnull/                              22-Feb-2021 12:18                   -
de.hirtenstrasse.michael.lnkshortener/             22-Feb-2021 12:18                   -
de.hoffmannsgimmicks/                              22-Feb-2021 12:18                   -
de.hoffmannsgimmickstaupunkt/                      22-Feb-2021 12:18                   -
de.hosenhasser.funktrainer/                        22-Feb-2021 12:18                   -
de.hskl.contacts/                                  22-Feb-2021 12:18                   -
de.hu_berlin.eduroam/                              22-Feb-2021 12:18                   -
de.hu_berlin.informatik.spws2014.mapever/          22-Feb-2021 12:18                   -
de.igloffstein.maik.aRevelation/                   22-Feb-2021 12:18                   -
de.j4velin.pedometer/                              22-Feb-2021 12:18                   -
de.j4velin.systemappmover/                         22-Feb-2021 12:18                   -
de.j4velin.wifiAutoOff/                            22-Feb-2021 12:18                   -
de.jdsoft.law/                                     22-Feb-2021 12:18                   -
de.jkliemann.parkendd/                             22-Feb-2021 12:18                   -
de.jugendhacker.xmppadmin/                         22-Feb-2021 12:18                   -
de.jurihock.voicesmith/                            22-Feb-2021 12:18                   -
de.k3b.android.calendar.ics.adapter/               22-Feb-2021 12:18                   -
de.k3b.android.contentproviderhelper/              22-Feb-2021 12:18                   -
de.k3b.android.intentintercept/                    22-Feb-2021 12:18                   -
de.k3b.android.locationMapViewer/                  22-Feb-2021 12:18                   -
de.k4ever.k4android/                               22-Feb-2021 12:18                   -
de.karbach.tac/                                    22-Feb-2021 12:18                   -
de.kodejak.hashr/                                  22-Feb-2021 12:18                   -
de.koelle.christian.trickytripper/                 22-Feb-2021 12:18                   -
de.kromke.andreas.mediascanner/                    22-Feb-2021 12:18                   -
de.kromke.andreas.musictagger/                     22-Feb-2021 12:18                   -
de.kromke.andreas.unpopmusicplayerfree/            22-Feb-2021 12:18                   -
de.ktran.anno1404warenrechner/                     22-Feb-2021 12:18                   -
de.kugihan.dictionaryformids.hmi_android/          22-Feb-2021 12:18                   -
de.langerhans.wallet/                              22-Feb-2021 12:18                   -
de.larcado.sesam/                                  22-Feb-2021 12:18                   -
de.laxu.apps.nachtlagerdownloader/                 22-Feb-2021 12:18                   -
de.lihotzki.pixelflood/                            22-Feb-2021 12:18                   -
de.lisas.alex.runuserinit/                         22-Feb-2021 12:18                   -
de.live.gdev.cherrymusic/                          22-Feb-2021 12:18                   -
de.live.gdev.timetracker/                          22-Feb-2021 12:18                   -
de.lsubel.amam/                                    22-Feb-2021 12:18                   -
de.luhmer.owncloudnewsreader/                      22-Feb-2021 12:18                   -
de.mangelow.balance/                               22-Feb-2021 12:18                   -
de.mangelow.debdroid/                              22-Feb-2021 12:18                   -
de.mangelow.network/                               22-Feb-2021 12:18                   -
de.mangelow.slideitloud/                           22-Feb-2021 12:18                   -
de.mangelow.syncwifi/                              22-Feb-2021 12:18                   -
de.mangelow.throughput/                            22-Feb-2021 12:18                   -
de.markusfisch.android.binaryeye/                  22-Feb-2021 12:18                   -
de.markusfisch.android.shadereditor/               22-Feb-2021 12:18                   -
de.markusfisch.android.wavelines/                  22-Feb-2021 12:18                   -
de.mbutscher.wikiandpad.alphabeta/                 22-Feb-2021 12:18                   -
de.measite.contactmerger/                          22-Feb-2021 12:18                   -
de.meonwax.soundboard/                             22-Feb-2021 12:18                   -
de.micmun.android.deufeitage/                      22-Feb-2021 12:18                   -
de.mpg.mpdl.labcam/                                22-Feb-2021 12:18                   -
de.mreiter.countit/                                22-Feb-2021 12:18                   -
de.msal.muzei.nationalgeographic/                  22-Feb-2021 12:18                   -
de.naturalnet.mirwtfapp/                           22-Feb-2021 12:18                   -
de.nellessen.usercontrolleddecryptionoperations/   22-Feb-2021 12:18                   -
de.nodomain.tobihille.seniorlauncher/              22-Feb-2021 12:18                   -
de.onyxbits.droidentify/                           22-Feb-2021 12:18                   -
de.onyxbits.drudgery/                              22-Feb-2021 12:18                   -
de.onyxbits.geobookmark/                           22-Feb-2021 12:18                   -
de.onyxbits.listmyapps/                            22-Feb-2021 12:18                   -
de.onyxbits.photobookmark/                         22-Feb-2021 12:18                   -
de.onyxbits.pocketbandit/                          22-Feb-2021 12:18                   -
de.onyxbits.remotekeyboard/                        22-Feb-2021 12:18                   -
de.onyxbits.sensorreadout/                         22-Feb-2021 12:18                   -
de.onyxbits.textfiction/                           22-Feb-2021 12:18                   -
de.perflyst.batterycalibration/                    22-Feb-2021 12:18                   -
de.perflyst.untis/                                 22-Feb-2021 12:18                   -
de.ph1b.audiobook/                                 22-Feb-2021 12:18                   -
de.phoenixstudios.pc_dimmer/                       22-Feb-2021 12:18                   -
de.php_tech.piggybudget/                           22-Feb-2021 12:18                   -
de.pinyto.exalteddicer/                            22-Feb-2021 12:18                   -
de.qspool.clementineremote/                        22-Feb-2021 12:18                   -
de.quaddyservices.dynamicnightlight/               22-Feb-2021 12:18                   -
de.r4md4c.gamedealz/                               22-Feb-2021 12:18                   -
de.rampro.activitydiary/                           22-Feb-2021 12:18                   -
de.reimardoeffinger.quickdic/                      22-Feb-2021 12:18                   -
de.repat.mosf/                                     22-Feb-2021 12:18                   -
de.retujo.bierverkostung/                          22-Feb-2021 12:18                   -
de.robv.android.xposed.installer/                  22-Feb-2021 12:18                   -
de.rwth_aachen.phyphox/                            22-Feb-2021 12:18                   -
de.saschahlusiak.freebloks/                        22-Feb-2021 12:18                   -
de.schaeuffelhut.android.openvpn/                  22-Feb-2021 12:18                   -
de.schildbach.oeffi/                               22-Feb-2021 12:18                   -
de.schildbach.wallet/                              22-Feb-2021 12:18                   -
de.schildbach.wallet.faircoin/                     22-Feb-2021 12:18                   -
de.schildbach.wallet_test/                         22-Feb-2021 12:18                   -
de.sensebox.blockly/                               22-Feb-2021 12:18                   -
de.serverfrog.pw.android/                          22-Feb-2021 12:18                   -
de.shandschuh.slightbackup/                        22-Feb-2021 12:18                   -
de.shandschuh.sparserss/                           22-Feb-2021 12:18                   -
de.sigfood/                                        22-Feb-2021 12:18                   -
de.simplestatswidget/                              22-Feb-2021 12:18                   -
de.skubware.opentraining/                          22-Feb-2021 12:18                   -
de.smasi.tickmate/                                 22-Feb-2021 12:18                   -
de.spiritcroc.darkcroc.substratum/                 22-Feb-2021 12:18                   -
de.spiritcroc.defaultdarktheme_oms/                22-Feb-2021 12:18                   -
de.spiritcroc.riotx/                               22-Feb-2021 12:18                   -
de.srlabs.gsmmap/                                  22-Feb-2021 12:18                   -
de.srlabs.snoopsnitch/                             22-Feb-2021 12:18                   -
de.stefan_oltmann.falling_blocks/                  22-Feb-2021 12:18                   -
de.stefan_oltmann.kaesekaestchen/                  22-Feb-2021 12:18                   -
de.steinpfeffer.rdt/                               22-Feb-2021 12:18                   -
de.stephanlindauer.criticalmaps/                   22-Feb-2021 12:18                   -
de.sudoq/                                          22-Feb-2021 12:18                   -
de.szalkowski.activitylauncher/                    22-Feb-2021 12:18                   -
de.t_dankworth.secscanqr/                          22-Feb-2021 12:18                   -
de.tap.easy_xkcd/                                  22-Feb-2021 12:18                   -
de.thecode.android.tazreader/                      22-Feb-2021 12:18                   -
de.tobiasbielefeld.brickgames/                     22-Feb-2021 12:18                   -
de.tobiasbielefeld.searchbar/                      22-Feb-2021 12:18                   -
de.tu_chemnitz.wlan/                               22-Feb-2021 12:18                   -
de.tui.itlogger/                                   22-Feb-2021 12:18                   -
de.tum.in.tumcampus/                               22-Feb-2021 12:18                   -
de.ub0r.android.clipboardbeam/                     22-Feb-2021 12:18                   -
de.ub0r.android.portaltimer/                       22-Feb-2021 12:18                   -
de.ub0r.android.smsdroid/                          22-Feb-2021 12:18                   -
de.ub0r.android.websms/                            22-Feb-2021 12:18                   -
de.uwepost.android.deltacam/                       22-Feb-2021 12:18                   -
de.vibora.viborafeed/                              22-Feb-2021 12:18                   -
de.we.acaldav/                                     22-Feb-2021 12:18                   -
de.westnordost.streetcomplete/                     22-Feb-2021 12:18                   -
de.wikilab.android.friendica01/                    22-Feb-2021 12:18                   -
de.wikilab.android.ldapsync/                       22-Feb-2021 12:18                   -
de.xskat/                                          22-Feb-2021 12:18                   -
de.yaacc/                                          22-Feb-2021 12:18                   -
de.yazo_games.mensaguthaben/                       22-Feb-2021 12:18                   -
de.zieren.rot13/                                   22-Feb-2021 12:18                   -
deep.ryd.rydplayer/                                22-Feb-2021 12:18                   -
dev.drsoran.moloko/                                22-Feb-2021 12:18                   -
dev.dworks.apps.anexplorer.pro/                    22-Feb-2021 12:18                   -
dev.jtsalva.cloudmare/                             22-Feb-2021 12:18                   -
dev.ukanth.ufirewall/                              22-Feb-2021 12:18                   -
dk.andsen.asqlitemanager/                          22-Feb-2021 12:18                   -
dk.jens.backup/                                    22-Feb-2021 12:18                   -
dk.kjeldsen.carwingsflutter/                       22-Feb-2021 12:18                   -
dk.meznik.jan.encrypttext/                         22-Feb-2021 12:18                   -
dk.nindroid.rss/                                   22-Feb-2021 12:18                   -
dmusiolik.pijaret/                                 22-Feb-2021 12:18                   -
dnsfilter.android/                                 22-Feb-2021 12:18                   -
douzifly.list/                                     22-Feb-2021 12:18                   -
dudeofx.eval/                                      22-Feb-2021 12:18                   -
edu.berkeley.boinc/                                22-Feb-2021 12:18                   -
edu.cmu.cs.speech.tts.flite/                       22-Feb-2021 12:18                   -
edu.cmu.cylab.starslinger/                         22-Feb-2021 12:18                   -
edu.cmu.cylab.starslinger.demo/                    22-Feb-2021 12:18                   -
edu.cmu.pocketsphinx.demo/                         22-Feb-2021 12:18                   -
edu.harvard.android.mmskeeper/                     22-Feb-2021 12:18                   -
edu.killerud.kitchentimer/                         22-Feb-2021 12:18                   -
edu.rit.poe.atomix/                                22-Feb-2021 12:18                   -
edu.sfsu.cs.orange.ocr/                            22-Feb-2021 12:18                   -
ee.ioc.phon.android.speak/                         22-Feb-2021 12:18                   -
ee.smkv.calc.loan/                                 22-Feb-2021 12:18                   -
email.schaal.ocreader/                             22-Feb-2021 12:18                   -
errorc2146.whereaminext/                           22-Feb-2021 12:18                   -
es.cesar.quitesleep/                               22-Feb-2021 12:18                   -
es.eoinrul.ecwt/                                   22-Feb-2021 12:18                   -
es.esy.CosyDVR/                                    22-Feb-2021 12:18                   -
es.usc.citius.servando.calendula/                  22-Feb-2021 12:18                   -
et.nWifiManager/                                   22-Feb-2021 12:18                   -
eu.depau.etchdroid/                                22-Feb-2021 12:18                   -
eu.devunit.fb_client/                              22-Feb-2021 12:18                   -
eu.domob.anacam/                                   22-Feb-2021 12:18                   -
eu.domob.angulo/                                   22-Feb-2021 12:18                   -
eu.domob.bjtrainer/                                22-Feb-2021 12:18                   -
eu.domob.shopt/                                    22-Feb-2021 12:18                   -
eu.droogers.smsmatrix/                             22-Feb-2021 12:18                   -
eu.e43.impeller/                                   22-Feb-2021 12:18                   -
eu.faircode.email/                                 22-Feb-2021 12:18                   -
eu.faircode.finegeotag/                            22-Feb-2021 12:18                   -
eu.faircode.netguard/                              22-Feb-2021 12:18                   -
eu.faircode.xlua/                                  22-Feb-2021 12:18                   -
eu.flatworld.android.slider/                       22-Feb-2021 12:18                   -
eu.halaser.beamctrl/                               22-Feb-2021 12:18                   -
eu.hydrologis.geopaparazzi/                        22-Feb-2021 12:18                   -
eu.inmite.android.gridwichterle/                   22-Feb-2021 12:18                   -
eu.johncasson.meerkatchallenge/                    22-Feb-2021 12:18                   -
eu.kanade.tachiyomi/                               22-Feb-2021 12:18                   -
eu.lavarde.pmtd/                                   22-Feb-2021 12:18                   -
eu.mrogalski.saidit/                               22-Feb-2021 12:18                   -
eu.polarclock/                                     22-Feb-2021 12:18                   -
eu.pretix.pretixdroid/                             22-Feb-2021 12:18                   -
eu.pretix.pretixprint/                             22-Feb-2021 12:18                   -
eu.pretix.pretixscan.droid/                        22-Feb-2021 12:18                   -
eu.prismsw.lampshade/                              22-Feb-2021 12:18                   -
eu.roggstar.luigithehunter.batterycalibrate/       22-Feb-2021 12:18                   -
eu.roggstar.luigithehunter.dsaassistent/           22-Feb-2021 12:18                   -
eu.siacs.conversations.legacy/                     22-Feb-2021 12:18                   -
eu.siacs.conversations.voicerecorder/              22-Feb-2021 12:18                   -
eu.siebeck.sipswitch/                              22-Feb-2021 12:18                   -
eu.uwot.fabio.altcoinprices/                       22-Feb-2021 12:18                   -
eu.veldsoft.brainstonz/                            22-Feb-2021 12:18                   -
eu.veldsoft.colors.overflow/                       22-Feb-2021 12:18                   -
eu.veldsoft.complica4/                             22-Feb-2021 12:18                   -
eu.veldsoft.dice.overflow/                         22-Feb-2021 12:18                   -
eu.veldsoft.fish.rings/                            22-Feb-2021 12:18                   -
eu.veldsoft.free.klondike/                         22-Feb-2021 12:18                   -
eu.veldsoft.house.of.cards/                        22-Feb-2021 12:18                   -
eu.veldsoft.hungarian.rings/                       22-Feb-2021 12:18                   -
eu.veldsoft.ithaka.board.game/                     22-Feb-2021 12:18                   -
eu.veldsoft.kechi/                                 22-Feb-2021 12:18                   -
eu.veldsoft.politrics/                             22-Feb-2021 12:18                   -
eu.veldsoft.scribe4/                               22-Feb-2021 12:18                   -
eu.veldsoft.svarka.odds.calculator/                22-Feb-2021 12:18                   -
eu.veldsoft.tri.peaks/                             22-Feb-2021 12:18                   -
eu.veldsoft.tuty.fruty.slot/                       22-Feb-2021 12:18                   -
eu.veldsoft.vitosha.blackjack/                     22-Feb-2021 12:18                   -
eu.veldsoft.vitosha.poker.odds/                    22-Feb-2021 12:18                   -
eu.veldsoft.vitoshadm/                             22-Feb-2021 12:18                   -
eu.vranckaert.worktime/                            22-Feb-2021 12:18                   -
eu.wikijourney.wikijourney/                        22-Feb-2021 12:18                   -
eu.woju.android.packages.hud/                      22-Feb-2021 12:18                   -
eun.initialvolume/                                 22-Feb-2021 12:18                   -
exa.lnx.a/                                         22-Feb-2021 12:18                   -
faenza.adw.theme/                                  22-Feb-2021 12:18                   -
felixwiemuth.lincal/                               22-Feb-2021 12:18                   -
fi.bitrite.android.ws/                             22-Feb-2021 12:18                   -
fi.harism.wallpaper.flier/                         22-Feb-2021 12:18                   -
fi.harism.wallpaper.flowers/                       22-Feb-2021 12:18                   -
fi.harism.wallpaper.yinyang/                       22-Feb-2021 12:18                   -
fi.kroon.vadret/                                   22-Feb-2021 12:18                   -
fi.testbed2/                                       22-Feb-2021 12:18                   -
fil.libre.repwifiapp/                              22-Feb-2021 12:18                   -
fly.speedmeter.grub/                               22-Feb-2021 12:18                   -
fm.a2d.sf/                                         22-Feb-2021 12:18                   -
fm.libre.droid/                                    22-Feb-2021 12:18                   -
foehnix.widget/                                    22-Feb-2021 12:18                   -
foundation.e.blisslauncher/                        22-Feb-2021 12:18                   -
fr.ac_versailles.dane.xiaexpress/                  22-Feb-2021 12:18                   -
fr.asterope/                                       22-Feb-2021 12:18                   -
fr.bellev.stdatmosphere/                           22-Feb-2021 12:18                   -
fr.bepo.clavierexterne/                            22-Feb-2021 12:18                   -
fr.byped.bwarearea/                                22-Feb-2021 12:18                   -
fr.cap_rel.fr.sagc_plongee.fr.nitroxCalc/          22-Feb-2021 12:18                   -
fr.free.nrw.commons/                               22-Feb-2021 12:18                   -
fr.gouv.android.stopcovid/                         22-Feb-2021 12:18                   -
fr.herverenault.directdictaphone/                  22-Feb-2021 12:18                   -
fr.hnit.babyname/                                  22-Feb-2021 12:18                   -
fr.hnit.riverferry/                                22-Feb-2021 12:18                   -
fr.jnda.android.flashalert/                        22-Feb-2021 12:18                   -
fr.keuse.rightsalert/                              22-Feb-2021 12:18                   -
fr.kwiatkowski.ApkTrack/                           22-Feb-2021 12:18                   -
fr.librinfo.evecontrol2/                           22-Feb-2021 12:18                   -
fr.ludo1520.whatexp/                               22-Feb-2021 12:18                   -
fr.magistry.taigime/                               22-Feb-2021 12:18                   -
fr.masciulli.drinks/                               22-Feb-2021 12:18                   -
fr.miximum.napply/                                 22-Feb-2021 12:18                   -
fr.mobdev.blooddonation/                           22-Feb-2021 12:18                   -
fr.mobdev.goblim/                                  22-Feb-2021 12:18                   -
fr.nicopico.dashclock.birthday/                    22-Feb-2021 12:18                   -
fr.nihilus.music/                                  22-Feb-2021 12:18                   -
fr.nocle.passegares/                               22-Feb-2021 12:18                   -
fr.pssoftware.scoretarot/                          22-Feb-2021 12:18                   -
fr.renzo.wikipoff/                                 22-Feb-2021 12:18                   -
fr.rhaz.ipfs.sweet/                                22-Feb-2021 12:18                   -
fr.s13d.photobackup/                               22-Feb-2021 12:18                   -
fr.s3i.pointeuse/                                  22-Feb-2021 12:18                   -
fr.seeks/                                          22-Feb-2021 12:18                   -
fr.simon.marquis.preferencesmanager/               22-Feb-2021 12:18                   -
fr.simon.marquis.secretcodes/                      22-Feb-2021 12:18                   -
fr.strasweb.asso/                                  22-Feb-2021 12:18                   -
fr.strasweb.browserquest/                          22-Feb-2021 12:18                   -
fr.strasweb.campus/                                22-Feb-2021 12:18                   -
fr.syncarnet/                                      22-Feb-2021 12:18                   -
fr.tvbarthel.apps.cameracolorpicker/               22-Feb-2021 12:18                   -
fr.tvbarthel.apps.simplethermometer/               22-Feb-2021 12:18                   -
fr.tvbarthel.apps.simpleweatherforcast/            22-Feb-2021 12:18                   -
fr.tvbarthel.attempt.googlyzooapp/                 22-Feb-2021 12:18                   -
fr.ubordeaux.math.paridroid/                       22-Feb-2021 12:18                   -
fr.unix_experience.owncloud_sms/                   22-Feb-2021 12:18                   -
fr.witchdoctors.c4ffein.oosfirmwareextractor/      22-Feb-2021 12:18                   -
fr.xgouchet.texteditor/                            22-Feb-2021 12:18                   -
fr.xplod.focal/                                    22-Feb-2021 12:18                   -
fr.xtof54.dragonGoApp/                             22-Feb-2021 12:18                   -
fr.xtof54.mousetodon/                              22-Feb-2021 12:18                   -
fr.xtof54.scrabble/                                22-Feb-2021 12:18                   -
fr.ybo.transportsbordeaux/                         22-Feb-2021 12:18                   -
fr.ybo.transportsrennes/                           22-Feb-2021 12:18                   -
free.rm.netcfgwidget/                              22-Feb-2021 12:18                   -
free.rm.skytube.oss/                               22-Feb-2021 12:18                   -
free.yhc.feeder/                                   22-Feb-2021 12:18                   -
free.yhc.netmbuddy/                                22-Feb-2021 12:18                   -
freemap.opentrail/                                 22-Feb-2021 12:18                   -
friimaind.piholedroid/                             22-Feb-2021 12:18                   -
ga.chschtsch.milonhapashut/                        22-Feb-2021 12:18                   -
genius.mohammad.floating.stickies/                 22-Feb-2021 12:18                   -
gg.mw.passera/                                     22-Feb-2021 12:18                   -
giraffine.dimmer/                                  22-Feb-2021 12:18                   -
git.rrgb.kinolog/                                  22-Feb-2021 12:18                   -
github.daneren2005.dsub/                           22-Feb-2021 12:18                   -
github.vatsal.easyweatherdemo/                     22-Feb-2021 12:18                   -
github.yaa110.memento/                             22-Feb-2021 12:18                   -
github.yaa110.piclice/                             22-Feb-2021 12:18                   -
goo.TeaTimer/                                      22-Feb-2021 12:18                   -
gq.nulldev.animeopenings.app/                      22-Feb-2021 12:18                   -
gr.ndre.scuttloid/                                 22-Feb-2021 12:18                   -
gr.ratmole.android.Mach3Pendant/                   22-Feb-2021 12:18                   -
groomiac.crocodilenote/                            22-Feb-2021 12:18                   -
hashengineering.darkcoin.wallet/                   22-Feb-2021 12:18                   -
headrevision.BehatReporter/                        22-Feb-2021 12:18                   -
home.jmstudios.calc/                               22-Feb-2021 12:18                   -
horse.amazin.my.stratum0.statuswidget/             22-Feb-2021 12:18                   -
hr.kravarscan.enchantedfortress/                   22-Feb-2021 12:18                   -
hsware.HSTempo/                                    22-Feb-2021 12:18                   -
hu.tagsoft.ttorrent.search/                        22-Feb-2021 12:18                   -
hu.vsza.adsdroid/                                  22-Feb-2021 12:18                   -
i4nc4mp.myLock/                                    22-Feb-2021 12:18                   -
idv.markkuo.ambitsync/                             22-Feb-2021 12:18                   -
im.pattle.app/                                     22-Feb-2021 12:18                   -
im.quicksy.client/                                 22-Feb-2021 12:18                   -
im.r_c.android.clearweather/                       22-Feb-2021 12:18                   -
im.r_c.android.jigsaw/                             22-Feb-2021 12:18                   -
im.tox.antox/                                      22-Feb-2021 12:18                   -
im.vector.alpha/                                   22-Feb-2021 12:18                   -
im.vector.riotx/                                   22-Feb-2021 12:18                   -
im.zom.messenger/                                  22-Feb-2021 12:18                   -
in.ac.dtu.subtlenews/                              22-Feb-2021 12:18                   -
in.ac.iitb.cse.cartsbusboarding/                   22-Feb-2021 12:18                   -
in.andres.kandroid/                                22-Feb-2021 12:18                   -
in.arjsna.permissionchecker/                       22-Feb-2021 12:18                   -
in.blogspot.anselmbros.torchie/                    22-Feb-2021 12:18                   -
in.indiandragon.shellshock.shellshockvulnerabil..> 22-Feb-2021 12:18                   -
in.p1x.tanks_of_freedom/                           22-Feb-2021 12:18                   -
in.shick.diode/                                    22-Feb-2021 12:18                   -
in.shick.lockpatterngenerator/                     22-Feb-2021 12:18                   -
in.umairkhan.remotedroid/                          22-Feb-2021 12:18                   -
indrora.atomic/                                    22-Feb-2021 12:18                   -
info.aario.killcamera/                             22-Feb-2021 12:18                   -
info.aario.mywifipasswords/                        22-Feb-2021 12:18                   -
info.aario.snotepad/                               22-Feb-2021 12:18                   -
info.dvkr.screenstream/                            22-Feb-2021 12:18                   -
info.frangor.laicare/                              22-Feb-2021 12:18                   -
info.guardianproject.checkey/                      22-Feb-2021 12:18                   -
info.guardianproject.courier/                      22-Feb-2021 12:18                   -
info.guardianproject.gilga/                        22-Feb-2021 12:18                   -
info.guardianproject.locationprivacy/              22-Feb-2021 12:18                   -
info.guardianproject.notepadbot/                   22-Feb-2021 12:18                   -
info.guardianproject.orfox/                        22-Feb-2021 12:18                   -
info.guardianproject.otr.app.im/                   22-Feb-2021 12:18                   -
info.guardianproject.pixelknot/                    22-Feb-2021 12:18                   -
info.kesavan.malartoon/                            22-Feb-2021 12:18                   -
info.lamatricexiste.network/                       22-Feb-2021 12:18                   -
info.meoblast001.thugaim/                          22-Feb-2021 12:18                   -
info.metadude.android.bitsundbaeume.schedule/      22-Feb-2021 12:18                   -
info.metadude.android.cccamp.schedule/             22-Feb-2021 12:18                   -
info.metadude.android.congress.schedule/           22-Feb-2021 12:18                   -
info.metadude.android.datenspuren.schedule/        22-Feb-2021 12:18                   -
info.metadude.android.divoc.schedule/              22-Feb-2021 12:18                   -
info.metadude.android.fosdem.schedule/             22-Feb-2021 12:18                   -
info.metadude.android.rc3.schedule/                22-Feb-2021 12:18                   -
info.papdt.blackblub/                              22-Feb-2021 12:18                   -
info.puzz.a10000sentences/                         22-Feb-2021 12:18                   -
info.schnatterer.nusic/                            22-Feb-2021 12:18                   -
info.staticfree.SuperGenPass/                      22-Feb-2021 12:18                   -
info.staticfree.android.robotfindskitten/          22-Feb-2021 12:18                   -
info.staticfree.android.twentyfourhour/            22-Feb-2021 12:18                   -
info.staticfree.android.units/                     22-Feb-2021 12:18                   -
info.tangential.cone/                              22-Feb-2021 12:18                   -
info.zamojski.soft.towercollector/                 22-Feb-2021 12:18                   -
info.zwanenburg.caffeinetile/                      22-Feb-2021 12:18                   -
io.anuke.mindustry/                                22-Feb-2021 12:18                   -
io.davidar.tensor/                                 22-Feb-2021 12:18                   -
io.github.alketii.mightyknight/                    22-Feb-2021 12:18                   -
io.github.benoitduffez.cupsprint/                  22-Feb-2021 12:18                   -
io.github.deweyreed.clipboardcleaner/              22-Feb-2021 12:18                   -
io.github.droidapps.pdfreader/                     22-Feb-2021 12:18                   -
io.github.engsergiu.react/                         22-Feb-2021 12:18                   -
io.github.fvasco.pinpoi/                           22-Feb-2021 12:18                   -
io.github.hidroh.materialistic/                    22-Feb-2021 12:18                   -
io.github.hopedia/                                 22-Feb-2021 12:18                   -
io.github.kobuge.games.minilens/                   22-Feb-2021 12:18                   -
io.github.lonamiwebs.klooni/                       22-Feb-2021 12:18                   -
io.github.lonamiwebs.stringlate/                   22-Feb-2021 12:18                   -
io.github.lufte.lona/                              22-Feb-2021 12:18                   -
io.github.mthli.Ninja/                             22-Feb-2021 12:18                   -
io.github.otakuchiyan.dnsman/                      22-Feb-2021 12:18                   -
io.github.phora.aeondroid/                         22-Feb-2021 12:18                   -
io.github.powerinside.scrollsocket/                22-Feb-2021 12:18                   -
io.github.powerinside.syncplay/                    22-Feb-2021 12:18                   -
io.github.project_travel_mate/                     22-Feb-2021 12:18                   -
io.github.sanbeg.flashlight/                       22-Feb-2021 12:18                   -
io.github.subhamtyagi.lastlauncher/                22-Feb-2021 12:18                   -
io.github.subhamtyagi.nightmode/                   22-Feb-2021 12:18                   -
io.github.subhamtyagi.openinwhatsapp/              22-Feb-2021 12:18                   -
io.github.subhamtyagi.privacyapplock/              22-Feb-2021 12:18                   -
io.github.thachillera.cardsscorekeeper/            22-Feb-2021 12:18                   -
io.github.tiagoshibata.gpsdclient/                 22-Feb-2021 12:18                   -
io.github.tjg1.nori/                               22-Feb-2021 12:18                   -
io.github.tompreuss.apnsettings/                   22-Feb-2021 12:18                   -
io.github.webbluetoothcg.bletestperipheral/        22-Feb-2021 12:18                   -
io.github.whirish.tvbuses/                         22-Feb-2021 12:18                   -
io.github.wulkanowy/                               22-Feb-2021 12:18                   -
io.githubfede0d.planetrider/                       22-Feb-2021 12:18                   -
io.gitlab.allenb1.todolist/                        22-Feb-2021 12:18                   -
io.gitlab.mudassir.youtubecacher/                  22-Feb-2021 12:18                   -
io.gresse.hugo.anecdote/                           22-Feb-2021 12:18                   -
io.homeassistant.android/                          22-Feb-2021 12:18                   -
io.homeassistant.companion.android.minimal/        22-Feb-2021 12:18                   -
io.mainframe.hacs/                                 22-Feb-2021 12:18                   -
io.mrarm.irc/                                      22-Feb-2021 12:18                   -
io.pslab/                                          22-Feb-2021 12:18                   -
io.tiph.smsspammer/                                22-Feb-2021 12:18                   -
io.trezor.app/                                     22-Feb-2021 12:18                   -
io.va.exposed/                                     22-Feb-2021 12:18                   -
io.wookey.wallet/                                  22-Feb-2021 12:18                   -
ir.hsn6.defendo/                                   22-Feb-2021 12:18                   -
ir.hsn6.k2/                                        22-Feb-2021 12:18                   -
ir.hsn6.tpb/                                       22-Feb-2021 12:18                   -
ir.hsn6.trans/                                     22-Feb-2021 12:18                   -
ir.hsn6.turo/                                      22-Feb-2021 12:18                   -
is.pinterjann.jaws/                                22-Feb-2021 12:18                   -
is.xyz.mpv/                                        22-Feb-2021 12:18                   -
is.xyz.omw/                                        22-Feb-2021 12:18                   -
is.xyz.omw_nightly/                                22-Feb-2021 12:18                   -
is.xyz.vcmi/                                       22-Feb-2021 12:18                   -
it.alessandropira.wesnoth114/                      22-Feb-2021 12:18                   -
it.andreascarpino.hostisdown/                      22-Feb-2021 12:18                   -
it.angrydroids.epub3reader/                        22-Feb-2021 12:18                   -
it.diab/                                           22-Feb-2021 12:18                   -
it.ecosw.dudo/                                     22-Feb-2021 12:18                   -
it.eternitywall.eternitywall/                      22-Feb-2021 12:18                   -
it.fabmazz.triestebus/                             22-Feb-2021 12:18                   -
it.faerb.crond/                                    22-Feb-2021 12:18                   -
it.fossoft.timberfoss/                             22-Feb-2021 12:18                   -
it.gmariotti.android.apps.dashclock.extensions...> 22-Feb-2021 12:18                   -
it.greenaddress.cordova/                           22-Feb-2021 12:18                   -
it.iiizio.epubator/                                22-Feb-2021 12:18                   -
it.langolonerd.app/                                22-Feb-2021 12:18                   -
it.lucci.cm.greyscaletheme/                        22-Feb-2021 12:18                   -
it.mn.salvi.linuxDayOSM/                           22-Feb-2021 12:18                   -
it.mobimentum.dualsimwidget/                       22-Feb-2021 12:18                   -
it.niedermann.owncloud.notes/                      22-Feb-2021 12:18                   -
it.reyboz.bustorino/                               22-Feb-2021 12:18                   -
it.reyboz.chordshift/                              22-Feb-2021 12:18                   -
it.reyboz.minesweeper/                             22-Feb-2021 12:18                   -
it.reyboz.screenlock/                              22-Feb-2021 12:18                   -
it.rgp.nyagua.pafcalc/                             22-Feb-2021 12:18                   -
it.rignanese.leo.slimfacebook/                     22-Feb-2021 12:18                   -
it.rignanese.leo.slimtwitter/                      22-Feb-2021 12:18                   -
it.sasabz.android.sasabus/                         22-Feb-2021 12:18                   -
it.sieke.android.cacertorgcertificateinstaller/    22-Feb-2021 12:18                   -
it.sineo.android.noFrillsCPUClassic/               22-Feb-2021 12:18                   -
it.skarafaz.mercury/                               22-Feb-2021 12:18                   -
italian.said.fran.theitaliansaid/                  22-Feb-2021 12:18                   -
itkach.aard2/                                      22-Feb-2021 12:18                   -
ivl.android.moneybalance/                          22-Feb-2021 12:18                   -
jackpal.androidterm/                               22-Feb-2021 12:18                   -
jackpal.droidexaminer/                             22-Feb-2021 12:18                   -
jonas.tool.saveForOffline/                         22-Feb-2021 12:18                   -
joshuatee.wx/                                      22-Feb-2021 12:18                   -
jp.co.kayo.android.localplayer/                    22-Feb-2021 12:18                   -
jp.co.kayo.android.localplayer.ds.ampache/         22-Feb-2021 12:18                   -
jp.co.kayo.android.localplayer.ds.podcast/         22-Feb-2021 12:18                   -
jp.co.omronsoft.openwnn/                           22-Feb-2021 12:18                   -
jp.co.qsdn.android.jinbei3d/                       22-Feb-2021 12:18                   -
jp.ddo.hotmist.unicodepad/                         22-Feb-2021 12:18                   -
jp.gr.java_conf.hatalab.mnv/                       22-Feb-2021 12:18                   -
jp.ksksue.app.terminal/                            22-Feb-2021 12:18                   -
jp.redmine.redmineclient/                          22-Feb-2021 12:18                   -
jp.sawada.np2android/                              22-Feb-2021 12:18                   -
jp.sblo.pandora.aGrep/                             22-Feb-2021 12:18                   -
jp.sfjp.webglmol.NDKmol/                           22-Feb-2021 12:18                   -
jp.softstudio.DriversLicenseReader/                22-Feb-2021 12:18                   -
jp.takke.cpustats/                                 22-Feb-2021 12:18                   -
jp.takke.datastats/                                22-Feb-2021 12:18                   -
jp.yhonda/                                         22-Feb-2021 12:18                   -
jpf.android.diary/                                 22-Feb-2021 12:18                   -
jpf.android.magiadni/                              22-Feb-2021 12:18                   -
julianwi.javainstaller/                            22-Feb-2021 12:18                   -
juliushenke.smarttt/                               22-Feb-2021 12:18                   -
jupiter.broadcasting.live.tv/                      22-Feb-2021 12:18                   -
jwtc.android.chess/                                22-Feb-2021 12:18                   -
kaba.yucata.envoy/                                 22-Feb-2021 12:18                   -
kaljurand_at_gmail_dot_com.diktofon/               22-Feb-2021 12:18                   -
kdk.android.simplydo/                              22-Feb-2021 12:18                   -
kellinwood.zipsigner2/                             22-Feb-2021 12:18                   -
kmac.dejavu_fonts/                                 22-Feb-2021 12:18                   -
koeln.mop.elpeefpe/                                22-Feb-2021 12:18                   -
kr.hybdms.sidepanel/                               22-Feb-2021 12:18                   -
kr.softgear.multiping/                             22-Feb-2021 12:18                   -
krasilnikov.alexey.cryptopass/                     22-Feb-2021 12:18                   -
kvj.taskw/                                         22-Feb-2021 12:18                   -
lanchon.sigspoof.checker/                          22-Feb-2021 12:18                   -
li.klass.fhem/                                     22-Feb-2021 12:18                   -
libretasks.app/                                    22-Feb-2021 12:18                   -
link.standen.michael.fatesheets/                   22-Feb-2021 12:18                   -
link.standen.michael.phonesaver/                   22-Feb-2021 12:18                   -
link.standen.michael.slideshow/                    22-Feb-2021 12:18                   -
lu.cases.tacos/                                    22-Feb-2021 12:18                   -
makeinfo.com.getid/                                22-Feb-2021 12:18                   -
mancioboxblog.altervista.it.volumecontrol/         22-Feb-2021 12:18                   -
marto.rtl_tcp_andro/                               22-Feb-2021 12:18                   -
mavonst.app.easylight/                             22-Feb-2021 12:18                   -
max.music_cyclon/                                  22-Feb-2021 12:18                   -
mazechazer.android.wottankquiz/                    22-Feb-2021 12:18                   -
mbmb5.lumixextendedcontrolapp/                     22-Feb-2021 12:18                   -
me.alexghr.bulkshare.android.app2/                 22-Feb-2021 12:18                   -
me.anon.grow/                                      22-Feb-2021 12:18                   -
me.anuraag.grader/                                 22-Feb-2021 12:18                   -
me.anuraag.loveactualized/                         22-Feb-2021 12:18                   -
me.blog.korn123.easydiary/                         22-Feb-2021 12:18                   -
me.bpear.archonpackager/                           22-Feb-2021 12:18                   -
me.ccrama.redditslide/                             22-Feb-2021 12:18                   -
me.echeung.cdflabs/                                22-Feb-2021 12:18                   -
me.echeung.moemoekyun.fdroid/                      22-Feb-2021 12:18                   -
me.guillaumin.android.osmtracker/                  22-Feb-2021 12:18                   -
me.hda.urlhda/                                     22-Feb-2021 12:18                   -
me.iacn.mbestyle/                                  22-Feb-2021 12:18                   -
me.jakelane.wrapperforfacebook/                    22-Feb-2021 12:18                   -
me.jamesfrost.simpledo/                            22-Feb-2021 12:18                   -
me.jfenn.alarmio/                                  22-Feb-2021 12:18                   -
me.johnmh.boogdroid/                               22-Feb-2021 12:18                   -
me.kavishhukmani.watwitchstickers/                 22-Feb-2021 12:18                   -
me.kuehle.carreport/                               22-Feb-2021 12:18                   -
me.malladi.dashcricket/                            22-Feb-2021 12:18                   -
me.murks.filmchecker/                              22-Feb-2021 12:18                   -
me.phh.superuser/                                  22-Feb-2021 12:18                   -
me.sheimi.sgit/                                    22-Feb-2021 12:18                   -
me.shrimadhavuk.numselapp/                         22-Feb-2021 12:18                   -
me.shrimadhavuk.watransmitter/                     22-Feb-2021 12:18                   -
me.tripsit.tripmobile/                             22-Feb-2021 12:18                   -
me.tsukanov.counter/                               22-Feb-2021 12:18                   -
me.wenxinwang.pulsedroidrtp/                       22-Feb-2021 12:18                   -
me.writeily/                                       22-Feb-2021 12:18                   -
me.zeeroooo.materialfb/                            22-Feb-2021 12:18                   -
menion.android.whereyougo/                         22-Feb-2021 12:18                   -
mixedbit.speechtrainer/                            22-Feb-2021 12:18                   -
mkg20001.net.samremote/                            22-Feb-2021 12:18                   -
mn.tck.semitone/                                   22-Feb-2021 12:18                   -
mobi.boilr.boilr/                                  22-Feb-2021 12:18                   -
mobi.cyann.nstools/                                22-Feb-2021 12:18                   -
mobi.maptrek/                                      22-Feb-2021 12:18                   -
mobi.omegacentauri.PerApp/                         22-Feb-2021 12:18                   -
mobi.omegacentauri.SendReduced/                    22-Feb-2021 12:18                   -
moe.feng.nhentai/                                  22-Feb-2021 12:18                   -
moe.minori.pgpclipper/                             22-Feb-2021 12:18                   -
mohammad.adib.roundr/                              22-Feb-2021 12:18                   -
monakhv.android.samlib/                            22-Feb-2021 12:18                   -
mono.hg/                                           22-Feb-2021 12:18                   -
name.bagi.levente.pedometer/                       22-Feb-2021 12:18                   -
name.boyle.chris.sgtpuzzles/                       22-Feb-2021 12:18                   -
name.gdr.acastus_photon/                           22-Feb-2021 12:18                   -
name.juodumas.ext_kbd_lithuanian/                  22-Feb-2021 12:18                   -
name.livitski.games.puzzle.android/                22-Feb-2021 12:18                   -
name.marfl.ext_kbd_bulgarian_phonetic/             22-Feb-2021 12:18                   -
name.seguri.android.getforegroundactivity/         22-Feb-2021 12:18                   -
name.seguri.android.isphoneencrypted/              22-Feb-2021 12:18                   -
name.seguri.android.lock/                          22-Feb-2021 12:18                   -
name.soulayrol.rhaa.sholi/                         22-Feb-2021 12:18                   -
name.starnberger.guenther.android.cbw/             22-Feb-2021 12:18                   -
namlit.siteswapgenerator/                          22-Feb-2021 12:18                   -
negativedensity.techahashi/                        22-Feb-2021 12:18                   -
net.aangle.rvclock/                                22-Feb-2021 12:18                   -
net.alaindonesia.silectric/                        22-Feb-2021 12:18                   -
net.alegen.android.netclip/                        22-Feb-2021 12:18                   -
net.androgames.level/                              22-Feb-2021 12:18                   -
net.androidcomics.acv/                             22-Feb-2021 12:18                   -
net.anzix.osm.upload/                              22-Feb-2021 12:18                   -
net.artificialworlds.rabbitescape/                 22-Feb-2021 12:18                   -
net.asceai.meritous/                               22-Feb-2021 12:18                   -
net.avs234/                                        22-Feb-2021 12:18                   -
net.basov.lws.fdroid/                              22-Feb-2021 12:18                   -
net.basov.lws.qr.fdroid/                           22-Feb-2021 12:18                   -
net.bierbaumer.otp_authenticator/                  22-Feb-2021 12:18                   -
net.bitconomy.ckpoolwatcher/                       22-Feb-2021 12:18                   -
net.bitplane.android.microphone/                   22-Feb-2021 12:18                   -
net.bluetoothviewer/                               22-Feb-2021 12:18                   -
net.bmaron.openfixmap/                             22-Feb-2021 12:18                   -
net.bytten.xkcdviewer/                             22-Feb-2021 12:18                   -
net.cactii.mathdoku/                               22-Feb-2021 12:18                   -
net.chilon.matt.teacup/                            22-Feb-2021 12:18                   -
net.codechunk.speedofsound/                        22-Feb-2021 12:18                   -
net.commotionwireless.meshtether/                  22-Feb-2021 12:18                   -
net.currit.tonality/                               22-Feb-2021 12:18                   -
net.cyclestreets/                                  22-Feb-2021 12:18                   -
net.czlee.debatekeeper/                            22-Feb-2021 12:18                   -
net.dahanne.android.regalandroid/                  22-Feb-2021 12:18                   -
net.dahanne.banq.notifications/                    22-Feb-2021 12:18                   -
net.damsy.soupeaucaillou.heriswap/                 22-Feb-2021 12:18                   -
net.damsy.soupeaucaillou.recursiveRunner/          22-Feb-2021 12:18                   -
net.daverix.urlforward/                            22-Feb-2021 12:18                   -
net.ddns.mlsoftlaberge.trycorder/                  22-Feb-2021 12:18                   -
net.debian.debiandroid/                            22-Feb-2021 12:18                   -
net.ebt.muzei.miyazaki/                            22-Feb-2021 12:18                   -
net.etuldan.sparss.floss/                          22-Feb-2021 12:18                   -
net.everythingandroid.smspopup/                    22-Feb-2021 12:18                   -
net.fabiszewski.ulogger/                           22-Feb-2021 12:18                   -
net.fercanet.LNM/                                  22-Feb-2021 12:18                   -
net.fred.feedex/                                   22-Feb-2021 12:18                   -
net.frju.flym/                                     22-Feb-2021 12:18                   -
net.gaast.giggity/                                 22-Feb-2021 12:18                   -
net.gcompris.full/                                 22-Feb-2021 12:18                   -
net.georgewhiteside.android.abstractart/           22-Feb-2021 12:18                   -
net.glsk.wpgen/                                    22-Feb-2021 12:18                   -
net.gorry.aicia/                                   22-Feb-2021 12:18                   -
net.gorry.android.input.nicownng/                  22-Feb-2021 12:18                   -
net.guildem.publicip/                              22-Feb-2021 12:18                   -
net.haltcondition.anode/                           22-Feb-2021 12:18                   -
net.healeys.lexic/                                 22-Feb-2021 12:18                   -
net.i2p.android/                                   22-Feb-2021 12:18                   -
net.i2p.android.router/                            22-Feb-2021 12:18                   -
net.iexos.musicalarm/                              22-Feb-2021 12:18                   -
net.inbox.pager/                                   22-Feb-2021 12:18                   -
net.iowaline.dotdash/                              22-Feb-2021 12:18                   -
net.jakevossen.apollotrivia/                       22-Feb-2021 12:18                   -
net.jaqpot.netcounter/                             22-Feb-2021 12:18                   -
net.jjc1138.android.scrobbler/                     22-Feb-2021 12:18                   -
net.justdave.nwsweatheralertswidget/               22-Feb-2021 12:18                   -
net.kervala.comicsreader/                          22-Feb-2021 12:18                   -
net.khertan.forrunners/                            22-Feb-2021 12:18                   -
net.kismetwireless.android.smarterwifimanager/     22-Feb-2021 12:18                   -
net.kourlas.voipms_sms/                            22-Feb-2021 12:18                   -
net.lardcave.keepassnfc/                           22-Feb-2021 12:18                   -
net.loeuillet.wifi_eap_sim_conf/                   22-Feb-2021 12:18                   -
net.logomancy.dashquotes.civ5/                     22-Feb-2021 12:18                   -
net.logomancy.diedroid/                            22-Feb-2021 12:18                   -
net.luniks.android.inetify/                        22-Feb-2021 12:18                   -
net.mabako.steamgifts/                             22-Feb-2021 12:18                   -
net.majorkernelpanic.spydroid/                     22-Feb-2021 12:18                   -
net.mcarolan.whenzebus/                            22-Feb-2021 12:18                   -
net.micode.compass/                                22-Feb-2021 12:18                   -
net.micode.fileexplorer/                           22-Feb-2021 12:18                   -
net.micode.soundrecorder/                          22-Feb-2021 12:18                   -
net.minetest.minetest/                             22-Feb-2021 12:18                   -
net.momodalo.app.vimtouch/                         22-Feb-2021 12:18                   -
net.mypapit.mobile.myposition/                     22-Feb-2021 12:18                   -
net.nightwhistler.pageturner/                      22-Feb-2021 12:18                   -
net.nitroshare.android/                            22-Feb-2021 12:18                   -
net.nullsum.audinaut/                              22-Feb-2021 12:18                   -
net.nullsum.freedoom/                              22-Feb-2021 12:18                   -
net.nurik.roman.dashclock/                         22-Feb-2021 12:18                   -
net.nurik.roman.muzei/                             22-Feb-2021 12:18                   -
net.opendasharchive.openarchive.release/           22-Feb-2021 12:18                   -
net.oschina.app/                                   22-Feb-2021 12:18                   -
net.osmand.parkingPlugin/                          22-Feb-2021 12:18                   -
net.osmand.plus/                                   22-Feb-2021 12:18                   -
net.osmand.srtmPlugin.paid/                        22-Feb-2021 12:18                   -
net.osmtracker/                                    22-Feb-2021 12:18                   -
net.pagekite.app/                                  22-Feb-2021 12:18                   -
net.pejici.easydice/                               22-Feb-2021 12:18                   -
net.pejici.summation/                              22-Feb-2021 12:18                   -
net.pherth.omnomagon/                              22-Feb-2021 12:18                   -
net.phunehehe.foocam/                              22-Feb-2021 12:18                   -
net.pierrox.mcompass/                              22-Feb-2021 12:18                   -
net.pmarks.chromadoze/                             22-Feb-2021 12:18                   -
net.pp3345.ykdroid/                                22-Feb-2021 12:18                   -
net.programmierecke.radiodroid2/                   22-Feb-2021 12:18                   -
net.progval.android.andquote/                      22-Feb-2021 12:18                   -
net.ralphbroenink.muzei.unsplash/                  22-Feb-2021 12:18                   -
net.rocboronat.android.wallpaper.npe/              22-Feb-2021 12:18                   -
net.rocrail.androc/                                22-Feb-2021 12:18                   -
net.schueller.peertube/                            22-Feb-2021 12:18                   -
net.screenfreeze.deskcon/                          22-Feb-2021 12:18                   -
net.sf.andbatdog.batterydog/                       22-Feb-2021 12:18                   -
net.sf.andhsli.hotspotlogin/                       22-Feb-2021 12:18                   -
net.sf.crypt.gort/                                 22-Feb-2021 12:18                   -
net.sf.ethersynth/                                 22-Feb-2021 12:18                   -
net.sf.times/                                      22-Feb-2021 12:18                   -
net.solutinno.websearch/                           22-Feb-2021 12:18                   -
net.somethingdreadful.MAL/                         22-Feb-2021 12:18                   -
net.sourceforge.andsys/                            22-Feb-2021 12:18                   -
net.sourceforge.dibdib.android.dib2qm/             22-Feb-2021 12:18                   -
net.sourceforge.kid3/                              22-Feb-2021 12:18                   -
net.sourceforge.opencamera/                        22-Feb-2021 12:18                   -
net.sourceforge.solitaire_cg/                      22-Feb-2021 12:18                   -
net.sourceforge.subsonic.androidapp/               22-Feb-2021 12:18                   -
net.sourceforge.wifiremoteplay/                    22-Feb-2021 12:18                   -
net.sourceforge.x11basic/                          22-Feb-2021 12:18                   -
net.stkaddons.viewer/                              22-Feb-2021 12:18                   -
net.syncthing.lite/                                22-Feb-2021 12:18                   -
net.syntaxblitz.plucklock/                         22-Feb-2021 12:18                   -
net.szym.barnacle/                                 22-Feb-2021 12:18                   -
net.taler.cashier/                                 22-Feb-2021 12:18                   -
net.taler.merchantpos/                             22-Feb-2021 12:18                   -
net.taler.wallet.fdroid/                           22-Feb-2021 12:18                   -
net.tapi.handynotes/                               22-Feb-2021 12:18                   -
net.tedstein.AndroSS/                              22-Feb-2021 12:18                   -
net.teknoraver.andhrystone/                        22-Feb-2021 12:18                   -
net.tevp.postcode/                                 22-Feb-2021 12:18                   -
net.thauvin.erik.android.noussd/                   22-Feb-2021 12:18                   -
net.tjado.passwdsafe/                              22-Feb-2021 12:18                   -
net.typeblog.shelter/                              22-Feb-2021 12:18                   -
net.usikkert.kouchat.android/                      22-Feb-2021 12:18                   -
net.vivekiyer.GAL/                                 22-Feb-2021 12:18                   -
net.vreeken.quickmsg/                              22-Feb-2021 12:18                   -
net.wigle.wigleandroid/                            22-Feb-2021 12:18                   -
net.xenotropic.quizznworldcap/                     22-Feb-2021 12:18                   -
net.xvello.salasana/                               22-Feb-2021 12:18                   -
net.yolosec.routerkeygen2/                         22-Feb-2021 12:18                   -
net.yxejamir.misbotheringsms/                      22-Feb-2021 12:18                   -
net.zygotelabs.locker/                             22-Feb-2021 12:18                   -
network.ubic.ubic/                                 22-Feb-2021 12:18                   -
news.androidtv.launchonboot/                       22-Feb-2021 12:18                   -
nf.frex.android/                                   22-Feb-2021 12:18                   -
nightlock.peppercarrot/                            22-Feb-2021 12:18                   -
nitezh.ministock/                                  22-Feb-2021 12:18                   -
nl.asymmetrics.droidshows/                         22-Feb-2021 12:18                   -
nl.devluuk.sleepywifi/                             22-Feb-2021 12:18                   -
nl.eventinfra.wifisetup/                           22-Feb-2021 12:18                   -
nl.frankkie.bronylivewallpaper/                    22-Feb-2021 12:18                   -
nl.implode.regenalarm/                             22-Feb-2021 12:18                   -
nl.implode.weer/                                   22-Feb-2021 12:18                   -
nl.mpcjanssen.simpletask/                          22-Feb-2021 12:18                   -
nl.sogeti.android.gpstracker/                      22-Feb-2021 12:18                   -
nl.ttys0.simplec25k/                               22-Feb-2021 12:18                   -
nl.yoerinijs.notebuddy/                            22-Feb-2021 12:18                   -
no.rkkc.bysykkel/                                  22-Feb-2021 12:18                   -
nodomain.freeyourgadget.gadgetbridge/              22-Feb-2021 12:18                   -
nodomain.freeyourgadget.tpmsmonitor/               22-Feb-2021 12:18                   -
nu.firetech.android.pactrack/                      22-Feb-2021 12:18                   -
nu.firetech.android.wifiwarning/                   22-Feb-2021 12:18                   -
nya.miku.wishmaster/                               22-Feb-2021 12:18                   -
nz.gen.geek_central.ObjViewer/                     22-Feb-2021 12:18                   -
ohi.andre.consolelauncher/                         22-Feb-2021 12:18                   -
ohm.quickdice/                                     22-Feb-2021 12:18                   -
opencontacts.open.com.opencontacts/                22-Feb-2021 12:18                   -
openfoodfacts.github.scrachx.openbeauty/           22-Feb-2021 12:18                   -
openfoodfacts.github.scrachx.openfood/             22-Feb-2021 12:18                   -
orbitlivewallpaperfree.puzzleduck.com/             22-Feb-2021 12:18                   -
org.ab.x48/                                        22-Feb-2021 12:18                   -
org.adaway/                                        22-Feb-2021 12:18                   -
org.adblockplus.android/                           22-Feb-2021 12:18                   -
org.addhen.smssync/                                22-Feb-2021 12:18                   -
org.adw.launcher/                                  22-Feb-2021 12:18                   -
org.afhdownloader/                                 22-Feb-2021 12:18                   -
org.aja.flightmode/                                22-Feb-2021 12:18                   -
org.akvo.rsr.up/                                   22-Feb-2021 12:18                   -
org.ale.openwatch/                                 22-Feb-2021 12:18                   -
org.ale.scanner.zotero/                            22-Feb-2021 12:18                   -
org.ametro/                                        22-Feb-2021 12:18                   -
org.aminb.mathtools.app/                           22-Feb-2021 12:18                   -
org.amoradi.syncopoli/                             22-Feb-2021 12:18                   -
org.andglkmod.hunkypunk/                           22-Feb-2021 12:18                   -
org.andresoviedo.dddmodel2/                        22-Feb-2021 12:18                   -
org.androidappdev.batterywidget/                   22-Feb-2021 12:18                   -
org.androidappdev.wifiwidget/                      22-Feb-2021 12:18                   -
org.androidfromfrankfurt.archnews/                 22-Feb-2021 12:18                   -
org.androidpn.client/                              22-Feb-2021 12:18                   -
org.androidsoft.app.permission/                    22-Feb-2021 12:18                   -
org.androidsoft.coloring/                          22-Feb-2021 12:18                   -
org.androidsoft.games.memory.tux/                  22-Feb-2021 12:18                   -
org.androidsoft.games.puzzle.kids/                 22-Feb-2021 12:18                   -
org.androidsoft.games.slowit/                      22-Feb-2021 12:18                   -
org.andstatus.app/                                 22-Feb-2021 12:18                   -
org.anothermonitor/                                22-Feb-2021 12:18                   -
org.appsroid.fxpro/                                22-Feb-2021 12:18                   -
org.aprsdroid.app/                                 22-Feb-2021 12:18                   -
org.ardour/                                        22-Feb-2021 12:18                   -
org.artsoft.rocksndiamonds/                        22-Feb-2021 12:18                   -
org.asdtm.fas/                                     22-Feb-2021 12:18                   -
org.asdtm.goodweather/                             22-Feb-2021 12:18                   -
org.astonbitecode.rustkeylock/                     22-Feb-2021 12:18                   -
org.atai.TessUI/                                   22-Feb-2021 12:18                   -
org.atalk.android/                                 22-Feb-2021 12:18                   -
org.aykit.MyOwnNotes/                              22-Feb-2021 12:18                   -
org.balau.fakedawn/                                22-Feb-2021 12:18                   -
org.basketbuilddownloader/                         22-Feb-2021 12:18                   -
org.bc_bd.mrwhite/                                 22-Feb-2021 12:18                   -
org.beide.bomber/                                  22-Feb-2021 12:18                   -
org.beide.droidgain/                               22-Feb-2021 12:18                   -
org.berlin_vegan.bvapp/                            22-Feb-2021 12:18                   -
org.bienvenidoainternet.app/                       22-Feb-2021 12:18                   -
org.billthefarmer.accordion/                       22-Feb-2021 12:18                   -
org.billthefarmer.crossword/                       22-Feb-2021 12:18                   -
org.billthefarmer.currency/                        22-Feb-2021 12:18                   -
org.billthefarmer.diary/                           22-Feb-2021 12:18                   -
org.billthefarmer.editor/                          22-Feb-2021 12:18                   -
org.billthefarmer.melodeon/                        22-Feb-2021 12:18                   -
org.billthefarmer.scope/                           22-Feb-2021 12:18                   -
org.billthefarmer.shorty/                          22-Feb-2021 12:18                   -
org.billthefarmer.siggen/                          22-Feb-2021 12:18                   -
org.billthefarmer.tuner/                           22-Feb-2021 12:18                   -
org.birthdayadapter/                               22-Feb-2021 12:18                   -
org.bitbucket.tickytacky.mirrormirror/             22-Feb-2021 12:18                   -
org.blitzortung.android.app/                       22-Feb-2021 12:18                   -
org.blockinger.game/                               22-Feb-2021 12:18                   -
org.blokada.alarm/                                 22-Feb-2021 12:18                   -
org.bobstuff.bobball/                              22-Feb-2021 12:18                   -
org.bombusmod/                                     22-Feb-2021 12:18                   -
org.bottiger.podcast/                              22-Feb-2021 12:18                   -
org.brandroid.openmanager/                         22-Feb-2021 12:18                   -
org.briarproject.briar.android/                    22-Feb-2021 12:18                   -
org.broeuschmeul.android.gps.bluetooth.provider/   22-Feb-2021 12:18                   -
org.c_base.c_beam/                                 22-Feb-2021 12:18                   -
org.calyxinstitute.vpn/                            22-Feb-2021 12:18                   -
org.catrobat.paintroid/                            22-Feb-2021 12:18                   -
org.chorem.android.saymytexts/                     22-Feb-2021 12:18                   -
org.chrisbailey.todo/                              22-Feb-2021 12:18                   -
org.ciasaboark.tacere/                             22-Feb-2021 12:18                   -
org.cipherdyne.fwknop2/                            22-Feb-2021 12:18                   -
org.cmotc.tools.rotationlockpp/                    22-Feb-2021 12:18                   -
org.congresointeractivo.elegilegi/                 22-Feb-2021 12:18                   -
org.connectbot/                                    22-Feb-2021 12:18                   -
org.coolfrood.mytronome/                           22-Feb-2021 12:18                   -
org.coolreader/                                    22-Feb-2021 12:18                   -
org.covolunablu.marswallpaper/                     22-Feb-2021 12:18                   -
org.cprados.wificellmanager/                       22-Feb-2021 12:18                   -
org.creativecommons.thelist/                       22-Feb-2021 12:18                   -
org.crocodile.sbautologin/                         22-Feb-2021 12:18                   -
org.cry.otp/                                       22-Feb-2021 12:18                   -
org.csploit.android/                               22-Feb-2021 12:18                   -
org.cyanogenmod.great.freedom/                     22-Feb-2021 12:18                   -
org.cyanogenmod.oneclick/                          22-Feb-2021 12:18                   -
org.damazio.notifier/                              22-Feb-2021 12:18                   -
org.dash.electrum.electrum_dash/                   22-Feb-2021 12:18                   -
org.daylightingsociety.wherearetheeyes/            22-Feb-2021 12:18                   -
org.ddosolitary.okcagent/                          22-Feb-2021 12:18                   -
org.de.jmg.learn/                                  22-Feb-2021 12:18                   -
org.debian.eugen.headingcalculator/                22-Feb-2021 12:18                   -
org.decsync.cc/                                    22-Feb-2021 12:18                   -
org.decsync.sparss.floss/                          22-Feb-2021 12:18                   -
org.deluge.trireme/                                22-Feb-2021 12:18                   -
org.developfreedom.ccdroid.app/                    22-Feb-2021 12:18                   -
org.developfreedom.logmein/                        22-Feb-2021 12:18                   -
org.developfreedom.wordpowermadeeasy/              22-Feb-2021 12:18                   -
org.dgtale.icsimport/                              22-Feb-2021 12:18                   -
org.disroot.disrootapp/                            22-Feb-2021 12:18                   -
org.disrupted.rumble/                              22-Feb-2021 12:18                   -
org.diygenomics.pg/                                22-Feb-2021 12:18                   -
org.dmfs.tasks/                                    22-Feb-2021 12:18                   -
org.dnaq.dialer2/                                  22-Feb-2021 12:18                   -
org.documentfoundation.libreoffice/                22-Feb-2021 12:18                   -
org.dolphinemu.dolphinemu/                         22-Feb-2021 12:18                   -
org.domogik.domodroid13/                           22-Feb-2021 12:18                   -
org.doubango.imsdroid/                             22-Feb-2021 12:18                   -
org.dpadgett.timer/                                22-Feb-2021 12:18                   -
org.droidparts.battery_widget/                     22-Feb-2021 12:18                   -
org.droidseries/                                   22-Feb-2021 12:18                   -
org.droidtr.deletegapps/                           22-Feb-2021 12:18                   -
org.droidtr.keyboard/                              22-Feb-2021 12:18                   -
org.droidtr.termbin/                               22-Feb-2021 12:18                   -
org.droidupnp/                                     22-Feb-2021 12:18                   -
org.dsandler.apps.markers/                         22-Feb-2021 12:18                   -
org.durka.hallmonitor/                             22-Feb-2021 12:18                   -
org.dynalogin.android/                             22-Feb-2021 12:18                   -
org.dyndns.fules.ck/                               22-Feb-2021 12:18                   -
org.dyndns.ipignoli.petronius/                     22-Feb-2021 12:18                   -
org.dyndns.sven_ola.debian_kit/                    22-Feb-2021 12:18                   -
org.dyndns.warenix.web2pdf/                        22-Feb-2021 12:18                   -
org.dystopia.email/                                22-Feb-2021 12:18                   -
org.ea.sqrl/                                       22-Feb-2021 12:18                   -
org.easyrpg.player/                                22-Feb-2021 12:18                   -
org.edunivers.whereami/                            22-Feb-2021 12:18                   -
org.eehouse.android.xw4/                           22-Feb-2021 12:18                   -
org.eff.actioncenter/                              22-Feb-2021 12:18                   -
org.elijaxapps.androidxmrigminer/                  22-Feb-2021 12:18                   -
org.emergent.android.weave/                        22-Feb-2021 12:18                   -
org.emunix.unipatcher/                             22-Feb-2021 12:18                   -
org.envaya.sms/                                    22-Feb-2021 12:18                   -
org.epstudios.epmobile/                            22-Feb-2021 12:18                   -
org.epstudios.morbidmeter/                         22-Feb-2021 12:18                   -
org.equeim.tremotesf/                              22-Feb-2021 12:18                   -
org.esteban.piano/                                 22-Feb-2021 12:18                   -
org.ethack.orwall/                                 22-Feb-2021 12:18                   -
org.evilsoft.pathfinder.reference/                 22-Feb-2021 12:18                   -
org.example.rosary/                                22-Feb-2021 12:18                   -
org.fastergps/                                     22-Feb-2021 12:18                   -
org.fdroid.fdroid.ota/                             22-Feb-2021 12:18                   -
org.fdroid.fdroid.privileged/                      22-Feb-2021 12:18                   -
org.fdroid.fdroid.privileged.ota/                  22-Feb-2021 12:18                   -
org.fdroid.superuser/                              22-Feb-2021 12:18                   -
org.fedorahosted.freeotp/                          22-Feb-2021 12:18                   -
org.fitchfamily.android.dejavu/                    22-Feb-2021 12:18                   -
org.fitchfamily.android.gsmlocation/               22-Feb-2021 12:18                   -
org.fitchfamily.android.symphony/                  22-Feb-2021 12:18                   -
org.fitchfamily.android.wifi_backend/              22-Feb-2021 12:18                   -
org.floens.chan/                                   22-Feb-2021 12:18                   -
org.flyve.inventory.agent/                         22-Feb-2021 12:18                   -
org.flyve.mdm.agent/                               22-Feb-2021 12:18                   -
org.flyve.mdm.agent.mqtt/                          22-Feb-2021 12:18                   -
org.fossasia.badgemagic/                           22-Feb-2021 12:18                   -
org.fox.ttrss/                                     22-Feb-2021 12:18                   -
org.fox.tttrss/                                    22-Feb-2021 12:18                   -
org.freeminer.freeminer/                           22-Feb-2021 12:18                   -
org.freshrss.easyrss/                              22-Feb-2021 12:18                   -
org.froscon.schedule/                              22-Feb-2021 12:18                   -
org.galexander.sshd/                               22-Feb-2021 12:18                   -
org.gateshipone.odyssey/                           22-Feb-2021 12:18                   -
org.gc.networktester/                              22-Feb-2021 12:18                   -
org.gege.caldavsyncadapter/                        22-Feb-2021 12:18                   -
org.geometerplus.fbreader.plugin.local_opds_sca..> 22-Feb-2021 12:18                   -
org.geometerplus.fbreader.plugin.tts/              22-Feb-2021 12:18                   -
org.geometerplus.zlibrary.ui.android/              22-Feb-2021 12:18                   -
org.gfd.gsmlocation/                               22-Feb-2021 12:18                   -
org.gitorious.jamesjrh.isokeys/                    22-Feb-2021 12:18                   -
org.gittner.osmbugs/                               22-Feb-2021 12:18                   -
org.glucosio.android/                              22-Feb-2021 12:18                   -
org.gmote.client.android/                          22-Feb-2021 12:18                   -
org.gnu.icecat/                                    22-Feb-2021 12:18                   -
org.gnucash.android/                               22-Feb-2021 12:18                   -
org.grapentin.apps.exceer/                         22-Feb-2021 12:18                   -
org.gringene.colourclock/                          22-Feb-2021 12:18                   -
org.gringene.concentricclock/                      22-Feb-2021 12:18                   -
org.handmadeideas.chordreader/                     22-Feb-2021 12:18                   -
org.hanenoshino.onscripter/                        22-Feb-2021 12:18                   -
org.happypeng.sumatora.android.sumatoradictionary/ 22-Feb-2021 12:18                   -
org.happysanta.gd/                                 22-Feb-2021 12:18                   -
org.hekmatof.chesswatch/                           22-Feb-2021 12:18                   -
org.helllabs.android.xmp/                          22-Feb-2021 12:18                   -
org.hermit.tricorder/                              22-Feb-2021 12:18                   -
org.herrlado.ask.languagepack.czech/               22-Feb-2021 12:18                   -
org.herrlado.ask.languagepack.lithuanian/          22-Feb-2021 12:18                   -
org.herrlado.geofonts/                             22-Feb-2021 12:18                   -
org.hiittimer.hiittimer/                           22-Feb-2021 12:18                   -
org.hoi_polloi.android.ringcode/                   22-Feb-2021 12:18                   -
org.holylobster.nuntius/                           22-Feb-2021 12:18                   -
org.horaapps.leafpic/                              22-Feb-2021 12:18                   -
org.hwyl.sexytopo/                                 22-Feb-2021 12:18                   -
org.hystudio.android.dosbox/                       22-Feb-2021 12:18                   -
org.icasdri.mather/                                22-Feb-2021 12:18                   -
org.iilab.openmentoring/                           22-Feb-2021 12:18                   -
org.iilab.pb/                                      22-Feb-2021 12:18                   -
org.indywidualni.fblite/                           22-Feb-2021 12:18                   -
org.ironrabbit/                                    22-Feb-2021 12:18                   -
org.ironrabbit.bhoboard/                           22-Feb-2021 12:18                   -
org.isoron.uhabits/                                22-Feb-2021 12:18                   -
org.itishka.pointim/                               22-Feb-2021 12:18                   -
org.jak_linux.dns66/                               22-Feb-2021 12:18                   -
org.jamienicol.episodes/                           22-Feb-2021 12:18                   -
org.janb.shoppinglist/                             22-Feb-2021 12:18                   -
org.jessies.dalvikexplorer/                        22-Feb-2021 12:18                   -
org.jf.Penroser/                                   22-Feb-2021 12:18                   -
org.jfedor.frozenbubble/                           22-Feb-2021 12:18                   -
org.jfedor.nxtremotecontrol/                       22-Feb-2021 12:18                   -
org.jfet.batsHIIT/                                 22-Feb-2021 12:18                   -
org.jitsi.meet/                                    22-Feb-2021 12:18                   -
org.jmoyer.NotificationPlus/                       22-Feb-2021 12:18                   -
org.jschwab.openrecipes/                           22-Feb-2021 12:18                   -
org.jsharkey.sky/                                  22-Feb-2021 12:18                   -
org.jsl.shmp/                                      22-Feb-2021 12:18                   -
org.jsl.wfwt/                                      22-Feb-2021 12:18                   -
org.jtb.alogcat/                                   22-Feb-2021 12:18                   -
org.jtb.droidlife/                                 22-Feb-2021 12:18                   -
org.jtb.httpmon/                                   22-Feb-2021 12:18                   -
org.jwz.xscreensaver/                              22-Feb-2021 12:18                   -
org.kaqui/                                         22-Feb-2021 12:18                   -
org.katsarov.dofcalc/                              22-Feb-2021 12:18                   -
org.katsarov.heatcalc/                             22-Feb-2021 12:18                   -
org.kaziprst.android.ndfilter/                     22-Feb-2021 12:18                   -
org.kde.kdeconnect_tp/                             22-Feb-2021 12:18                   -
org.kde.ktrip/                                     22-Feb-2021 12:18                   -
org.kde.necessitas.ministro/                       22-Feb-2021 12:18                   -
org.kiwix.kiwixcustomwikivoyageeurope/             22-Feb-2021 12:18                   -
org.kiwix.kiwixmobile/                             22-Feb-2021 12:18                   -
org.kobuge.ninjatraining/                          22-Feb-2021 12:18                   -
org.kore.kolabnotes.android/                       22-Feb-2021 12:18                   -
org.koreader.launcher/                             22-Feb-2021 12:18                   -
org.kost.nmap.android.networkmapper/               22-Feb-2021 12:18                   -
org.krita/                                         22-Feb-2021 12:18                   -
org.kwaak3/                                        22-Feb-2021 12:18                   -
org.legtux.m_316k.fortune/                         22-Feb-2021 12:18                   -
org.legtux.m_316k.taptheblacktiles/                22-Feb-2021 12:18                   -
org.lenchan139.ncbookmark/                         22-Feb-2021 12:18                   -
org.lf_net.pgpunlocker/                            22-Feb-2021 12:18                   -
org.liberty.android.fantastischmemo/               22-Feb-2021 12:18                   -
org.liberty.android.freeotpplus/                   22-Feb-2021 12:18                   -
org.libre.agosto.p2play/                           22-Feb-2021 12:18                   -
org.libreflix.app/                                 22-Feb-2021 12:18                   -
org.libreoffice.impressremote/                     22-Feb-2021 12:18                   -
org.ligi.ajsha/                                    22-Feb-2021 12:18                   -
org.ligi.blexplorer/                               22-Feb-2021 12:18                   -
org.ligi.etheremote/                               22-Feb-2021 12:18                   -
org.ligi.fast/                                     22-Feb-2021 12:18                   -
org.ligi.faster/                                   22-Feb-2021 12:18                   -
org.ligi.gobandroid_hd/                            22-Feb-2021 12:18                   -
org.ligi.ipfsdroid/                                22-Feb-2021 12:18                   -
org.ligi.materialteatimer/                         22-Feb-2021 12:18                   -
org.ligi.passandroid/                              22-Feb-2021 12:18                   -
org.ligi.satoshiproof/                             22-Feb-2021 12:18                   -
org.ligi.scr/                                      22-Feb-2021 12:18                   -
org.ligi.survivalmanual/                           22-Feb-2021 12:18                   -
org.ligi.vaporizercontrol/                         22-Feb-2021 12:18                   -
org.linphone/                                      22-Feb-2021 12:18                   -
org.logicallycreative.movingpolygons/              22-Feb-2021 12:18                   -
org.lufebe16.pysolfc/                              22-Feb-2021 12:18                   -
org.lumicall.android/                              22-Feb-2021 12:18                   -
org.macno.puma/                                    22-Feb-2021 12:18                   -
org.madore.android.unicodeMap/                     22-Feb-2021 12:18                   -
org.marcus905.wifi.ace/                            22-Feb-2021 12:18                   -
org.mariotaku.imageviewergl/                       22-Feb-2021 12:18                   -
org.mariotaku.twidere/                             22-Feb-2021 12:18                   -
org.mariotaku.twidere.extension.twitlonger/        22-Feb-2021 12:18                   -
org.materialos.icons/                              22-Feb-2021 12:18                   -
org.mbach.lemonde/                                 22-Feb-2021 12:18                   -
org.mcxa.softsound/                                22-Feb-2021 12:18                   -
org.mcxa.vortaro/                                  22-Feb-2021 12:18                   -
org.mcxa.zephyrlogger/                             22-Feb-2021 12:18                   -
org.miamplayer.autoairplanemode/                   22-Feb-2021 12:18                   -
org.mian.gitnex/                                   22-Feb-2021 12:18                   -
org.michaelevans.nightmodeenabler/                 22-Feb-2021 12:18                   -
org.microg.nlp/                                    22-Feb-2021 12:18                   -
org.microg.nlp.backend.apple/                      22-Feb-2021 12:18                   -
org.microg.nlp.backend.ichnaea/                    22-Feb-2021 12:18                   -
org.microg.nlp.backend.nominatim/                  22-Feb-2021 12:18                   -
org.microg.nlp.backend.openwlanmap/                22-Feb-2021 12:18                   -
org.mixare/                                        22-Feb-2021 12:18                   -
org.mmk2410.cyngn.theme.fira/                      22-Feb-2021 12:18                   -
org.moire.opensudoku/                              22-Feb-2021 12:18                   -
org.moire.ultrasonic/                              22-Feb-2021 12:18                   -
org.montrealtransit.android.schedule.stmbus/       22-Feb-2021 12:18                   -
org.moparisthebest.appbak/                         22-Feb-2021 12:18                   -
org.moparisthebest.pageplus/                       22-Feb-2021 12:18                   -
org.mosspaper/                                     22-Feb-2021 12:18                   -
org.mozc.android.inputmethod.japanese/             22-Feb-2021 12:18                   -
org.mozilla.fennec_fdroid/                         22-Feb-2021 12:18                   -
org.mozilla.klar/                                  22-Feb-2021 12:18                   -
org.mozilla.mozstumbler/                           22-Feb-2021 12:18                   -
org.mozilla.rocket/                                22-Feb-2021 12:18                   -
org.mult.daap/                                     22-Feb-2021 12:18                   -
org.mumod.android/                                 22-Feb-2021 12:18                   -
org.mupen64plusae.v3.alpha/                        22-Feb-2021 12:18                   -
org.musicbrainz.picard.barcodescanner/             22-Feb-2021 12:18                   -
org.musicpd/                                       22-Feb-2021 12:18                   -
org.mustard.android/                               22-Feb-2021 12:18                   -
org.mysociety.FixMyStreet/                         22-Feb-2021 12:18                   -
org.mythdroid/                                     22-Feb-2021 12:18                   -
org.n52.sosmobileclient/                           22-Feb-2021 12:18                   -
org.nathan.jf.build.prop.editor/                   22-Feb-2021 12:18                   -
org.navitproject.navit/                            22-Feb-2021 12:18                   -
org.ncrmnt.nettts/                                 22-Feb-2021 12:18                   -
org.ndeftools.boilerplate/                         22-Feb-2021 12:18                   -
org.nerdcircus.android.klaxon/                     22-Feb-2021 12:18                   -
org.nick.cryptfs.passwdmanager/                    22-Feb-2021 12:18                   -
org.nick.wwwjdic/                                  22-Feb-2021 12:18                   -
org.ninthfloor.copperpdf/                          22-Feb-2021 12:18                   -
org.nitri.opentopo/                                22-Feb-2021 12:18                   -
org.npr.android.news/                              22-Feb-2021 12:18                   -
org.ntpsync/                                       22-Feb-2021 12:18                   -
org.numixproject.iconsubmit/                       22-Feb-2021 12:18                   -
org.nutritionfacts.dailydozen/                     22-Feb-2021 12:18                   -
org.nv95.openmanga/                                22-Feb-2021 12:18                   -
org.ocsinventoryng.android.agent/                  22-Feb-2021 12:18                   -
org.odk.collect.android/                           22-Feb-2021 12:18                   -
org.og8.a1tox/                                     22-Feb-2021 12:18                   -
org.ogre.browser/                                  22-Feb-2021 12:18                   -
org.okfn.pod/                                      22-Feb-2021 12:18                   -
org.olgsoft.apipepanic/                            22-Feb-2021 12:18                   -
org.olpc_france.sugarizer/                         22-Feb-2021 12:18                   -
org.openbmap/                                      22-Feb-2021 12:18                   -
org.openbmap.unifiedNlp/                           22-Feb-2021 12:18                   -
org.opendroidphp/                                  22-Feb-2021 12:18                   -
org.openfoodfacts.scanner/                         22-Feb-2021 12:18                   -
org.opengappsdownloader/                           22-Feb-2021 12:18                   -
org.opengemara.shiurim/                            22-Feb-2021 12:18                   -
org.opengpx/                                       22-Feb-2021 12:18                   -
org.openintents.about/                             22-Feb-2021 12:18                   -
org.openintents.filemanager/                       22-Feb-2021 12:18                   -
org.openintents.flashlight/                        22-Feb-2021 12:18                   -
org.openintents.notepad/                           22-Feb-2021 12:18                   -
org.openintents.safe/                              22-Feb-2021 12:18                   -
org.openintents.shopping/                          22-Feb-2021 12:18                   -
org.openlp.android/                                22-Feb-2021 12:18                   -
org.openlp.android2/                               22-Feb-2021 12:18                   -
org.openmsx.android.openmsx/                       22-Feb-2021 12:18                   -
org.openobservatory.ooniprobe/                     22-Feb-2021 12:18                   -
org.openorienteering.mapper/                       22-Feb-2021 12:18                   -
org.openpetfoodfacts.scanner/                      22-Feb-2021 12:18                   -
org.opentech/                                      22-Feb-2021 12:18                   -
org.openttd.sdl/                                   22-Feb-2021 12:18                   -
org.osmdroid/                                      22-Feb-2021 12:18                   -
org.osmocom.tacdatabaseclient/                     22-Feb-2021 12:18                   -
org.ostrya.presencepublisher/                      22-Feb-2021 12:18                   -
org.pacien.tincapp/                                22-Feb-2021 12:18                   -
org.paladyn.mediclog/                              22-Feb-2021 12:18                   -
org.passwordmaker.android/                         22-Feb-2021 12:18                   -
org.paulmach.textedit/                             22-Feb-2021 12:18                   -
org.peterbaldwin.client.android.tinyurl/           22-Feb-2021 12:18                   -
org.peterbaldwin.client.android.vlcremote/         22-Feb-2021 12:18                   -
org.petero.droidfish/                              22-Feb-2021 12:18                   -
org.pipoypipagames.towerjumper/                    22-Feb-2021 12:18                   -
org.piwik.mobile2/                                 22-Feb-2021 12:18                   -
org.pixmob.freemobile.netstat/                     22-Feb-2021 12:18                   -
org.pocketworkstation.pckeyboard/                  22-Feb-2021 12:18                   -
org.poirsouille.tinc_gui/                          22-Feb-2021 12:18                   -
org.poopeeland.tinytinyfeed/                       22-Feb-2021 12:18                   -
org.ppsspp.ppsspp/                                 22-Feb-2021 12:18                   -
org.primftpd/                                      22-Feb-2021 12:18                   -
org.privacyhelper/                                 22-Feb-2021 12:18                   -
org.projectmaxs.main/                              22-Feb-2021 12:18                   -
org.projectmaxs.module.alarmset/                   22-Feb-2021 12:18                   -
org.projectmaxs.module.bluetooth/                  22-Feb-2021 12:18                   -
org.projectmaxs.module.bluetoothadmin/             22-Feb-2021 12:18                   -
org.projectmaxs.module.clipboard/                  22-Feb-2021 12:18                   -
org.projectmaxs.module.contactsread/               22-Feb-2021 12:18                   -
org.projectmaxs.module.fileread/                   22-Feb-2021 12:18                   -
org.projectmaxs.module.filewrite/                  22-Feb-2021 12:18                   -
org.projectmaxs.module.locationfine/               22-Feb-2021 12:18                   -
org.projectmaxs.module.misc/                       22-Feb-2021 12:18                   -
org.projectmaxs.module.nfc/                        22-Feb-2021 12:18                   -
org.projectmaxs.module.notification/               22-Feb-2021 12:18                   -
org.projectmaxs.module.phonestateread/             22-Feb-2021 12:18                   -
org.projectmaxs.module.ringermode/                 22-Feb-2021 12:18                   -
org.projectmaxs.module.shell/                      22-Feb-2021 12:18                   -
org.projectmaxs.module.smsnotify/                  22-Feb-2021 12:18                   -
org.projectmaxs.module.smsread/                    22-Feb-2021 12:18                   -
org.projectmaxs.module.smssend/                    22-Feb-2021 12:18                   -
org.projectmaxs.module.smswrite/                   22-Feb-2021 12:18                   -
org.projectmaxs.module.wifiaccess/                 22-Feb-2021 12:18                   -
org.projectmaxs.module.wifichange/                 22-Feb-2021 12:18                   -
org.projectmaxs.transport.xmpp/                    22-Feb-2021 12:18                   -
org.projectvoodoo.otarootkeeper/                   22-Feb-2021 12:18                   -
org.projectvoodoo.screentestpatterns/              22-Feb-2021 12:18                   -
org.projectvoodoo.simplecarrieriqdetector/         22-Feb-2021 12:18                   -
org.pulpdust.lesserpad/                            22-Feb-2021 12:18                   -
org.pyload.android.client/                         22-Feb-2021 12:18                   -
org.pyneo.maps/                                    22-Feb-2021 12:18                   -
org.qii.weiciyuan/                                 22-Feb-2021 12:18                   -
org.quantumbadger.redreader/                       22-Feb-2021 12:18                   -
org.quovadit.apps.andof/                           22-Feb-2021 12:18                   -
org.recentwidget/                                  22-Feb-2021 12:18                   -
org.redcross.openmapkit/                           22-Feb-2021 12:18                   -
org.retroshare.android.qml_app/                    22-Feb-2021 12:18                   -
org.rmll/                                          22-Feb-2021 12:18                   -
org.runnerup/                                      22-Feb-2021 12:18                   -
org.runnerup.free/                                 22-Feb-2021 12:18                   -
org.safecoin.safeprice/                            22-Feb-2021 12:18                   -
org.safermobile.intheclear/                        22-Feb-2021 12:18                   -
org.sagemath.droid/                                22-Feb-2021 12:18                   -
org.saiditnet.redreader/                           22-Feb-2021 12:18                   -
org.sasehash.burgerwp/                             22-Feb-2021 12:18                   -
org.savapage.android.print/                        22-Feb-2021 12:18                   -
org.schabi.etherwake/                              22-Feb-2021 12:18                   -
org.schabi.kiba/                                   22-Feb-2021 12:18                   -
org.schabi.newpipe/                                22-Feb-2021 12:18                   -
org.schabi.newpipelegacy/                          22-Feb-2021 12:18                   -
org.schabi.nxbookmarks/                            22-Feb-2021 12:18                   -
org.schabi.nxbookmarks.owncloud/                   22-Feb-2021 12:18                   -
org.schabi.openhitboxstreams/                      22-Feb-2021 12:18                   -
org.schabi.stethox/                                22-Feb-2021 12:18                   -
org.schabi.svgredirect/                            22-Feb-2021 12:18                   -
org.schabi.terminightor/                           22-Feb-2021 12:18                   -
org.scid.android/                                  22-Feb-2021 12:18                   -
org.scoutant.blokish/                              22-Feb-2021 12:18                   -
org.scoutant.cc/                                   22-Feb-2021 12:18                   -
org.scoutant.rpn/                                  22-Feb-2021 12:18                   -
org.scummvm.scummvm/                               22-Feb-2021 12:18                   -
org.seamapdroid/                                   22-Feb-2021 12:18                   -
org.secuso.privacyfriendly2048/                    22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyactivitytracker/         22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyboardgameclock/          22-Feb-2021 12:18                   -
org.secuso.privacyfriendlycardgameone/             22-Feb-2021 12:18                   -
org.secuso.privacyfriendlycircuittraining/         22-Feb-2021 12:18                   -
org.secuso.privacyfriendlydame/                    22-Feb-2021 12:18                   -
org.secuso.privacyfriendlydicer/                   22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyfinancemanager/          22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyfoodtracker/             22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyintervaltimer/           22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyludo/                    22-Feb-2021 12:18                   -
org.secuso.privacyfriendlymemory/                  22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyminesweeper/             22-Feb-2021 12:18                   -
org.secuso.privacyfriendlynetmonitor/              22-Feb-2021 12:18                   -
org.secuso.privacyfriendlynotes/                   22-Feb-2021 12:18                   -
org.secuso.privacyfriendlypaindiary/               22-Feb-2021 12:18                   -
org.secuso.privacyfriendlypasswordgenerator/       22-Feb-2021 12:18                   -
org.secuso.privacyfriendlypausinghealthily/        22-Feb-2021 12:18                   -
org.secuso.privacyfriendlypin/                     22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyrecknoningskills/        22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyruler/                   22-Feb-2021 12:18                   -
org.secuso.privacyfriendlysketching/               22-Feb-2021 12:18                   -
org.secuso.privacyfriendlysolitaire/               22-Feb-2021 12:18                   -
org.secuso.privacyfriendlysudoku/                  22-Feb-2021 12:18                   -
org.secuso.privacyfriendlytapemeasure/             22-Feb-2021 12:18                   -
org.secuso.privacyfriendlytodolist/                22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyweather/                 22-Feb-2021 12:18                   -
org.secuso.privacyfriendlywifimanager/             22-Feb-2021 12:18                   -
org.secuso.privacyfriendlyyahtzeedicer/            22-Feb-2021 12:18                   -
org.segin.bfinterpreter/                           22-Feb-2021 12:18                   -
org.segin.ttleditor/                               22-Feb-2021 12:18                   -
org.sensors2.osc/                                  22-Feb-2021 12:18                   -
org.sensors2.pd/                                   22-Feb-2021 12:18                   -
org.servDroid.web/                                 22-Feb-2021 12:18                   -
org.servalproject/                                 22-Feb-2021 12:18                   -
org.shadowice.flocke.andotp/                       22-Feb-2021 12:18                   -
org.shirakumo.ocelot/                              22-Feb-2021 12:18                   -
org.shortcuts/                                     22-Feb-2021 12:18                   -
org.sickstache/                                    22-Feb-2021 12:18                   -
org.sipdroid.sipua/                                22-Feb-2021 12:18                   -
org.sixgun.ponyexpress/                            22-Feb-2021 12:18                   -
org.smblott.intentradio/                           22-Feb-2021 12:18                   -
org.smc.inputmethod.indic/                         22-Feb-2021 12:18                   -
org.smerty.zooborns/                               22-Feb-2021 12:18                   -
org.smssecure.smssecure/                           22-Feb-2021 12:18                   -
org.softcatala.traductor/                          22-Feb-2021 12:18                   -
org.softeg.slartus.forpdaplus/                     22-Feb-2021 12:18                   -
org.solovyev.android.calculator/                   22-Feb-2021 12:18                   -
org.sorz.lab.tinykeepass/                          22-Feb-2021 12:18                   -
org.sparkleshare.android/                          22-Feb-2021 12:18                   -
org.strawberryforum.pollywog/                      22-Feb-2021 12:18                   -
org.subsurface/                                    22-Feb-2021 12:18                   -
org.sudowars/                                      22-Feb-2021 12:18                   -
org.sufficientlysecure.ical/                       22-Feb-2021 12:18                   -
org.sufficientlysecure.keychain/                   22-Feb-2021 12:18                   -
org.sufficientlysecure.localcalendar/              22-Feb-2021 12:18                   -
org.sufficientlysecure.standalonecalendar/         22-Feb-2021 12:18                   -
org.sufficientlysecure.termbot/                    22-Feb-2021 12:18                   -
org.sufficientlysecure.viewer/                     22-Feb-2021 12:18                   -
org.sufficientlysecure.viewer.fontpack/            22-Feb-2021 12:18                   -
org.sugr.gearshift/                                22-Feb-2021 12:18                   -
org.supertuxkart.stk/                              22-Feb-2021 12:18                   -
org.surrel.facebooknotifications/                  22-Feb-2021 12:18                   -
org.surrel.messengerbypasser/                      22-Feb-2021 12:18                   -
org.synergy/                                       22-Feb-2021 12:18                   -
org.systemcall.scores/                             22-Feb-2021 12:18                   -
org.t2.synconwifi/                                 22-Feb-2021 12:18                   -
org.tamanegi.atmosphere/                           22-Feb-2021 12:18                   -
org.tamanegi.wallpaper.multipicture.dnt/           22-Feb-2021 12:18                   -
org.tasks/                                         22-Feb-2021 12:18                   -
org.tbrk.mnemododo/                                22-Feb-2021 12:18                   -
org.tether.tether/                                 22-Feb-2021 12:18                   -
org.thecongers.mtpms/                              22-Feb-2021 12:18                   -
org.thialfihar.android.apg/                        22-Feb-2021 12:18                   -
org.thiolliere.youtubestream/                      22-Feb-2021 12:18                   -
org.tigase.messenger.phone.pro/                    22-Feb-2021 12:18                   -
org.tint/                                          22-Feb-2021 12:18                   -
org.tint.adblock/                                  22-Feb-2021 12:18                   -
org.tlhInganHol.android.klingonassistant/          22-Feb-2021 12:18                   -
org.tmurakam.presentationtimer/                    22-Feb-2021 12:18                   -
org.tof/                                           22-Feb-2021 12:18                   -
org.tomdroid/                                      22-Feb-2021 12:18                   -
org.torproject.android/                            22-Feb-2021 12:18                   -
org.totschnig.sendwithftp/                         22-Feb-2021 12:18                   -
org.toulibre.capitoledulibre/                      22-Feb-2021 12:18                   -
org.traccar.client/                                22-Feb-2021 12:18                   -
org.transdroid.full/                               22-Feb-2021 12:18                   -
org.transdroid.lite/                               22-Feb-2021 12:18                   -
org.transdroid.search/                             22-Feb-2021 12:18                   -
org.tryton.client/                                 22-Feb-2021 12:18                   -
org.ttrssreader/                                   22-Feb-2021 12:18                   -
org.tunesremote/                                   22-Feb-2021 12:18                   -
org.tvheadend.tvhguide/                            22-Feb-2021 12:18                   -
org.uaraven.e/                                     22-Feb-2021 12:18                   -
org.us.andriod/                                    22-Feb-2021 12:18                   -
org.valos.isolmoa/                                 22-Feb-2021 12:18                   -
org.vi_server.red_screen/                          22-Feb-2021 12:18                   -
org.videolan.vlc/                                  22-Feb-2021 12:18                   -
org.voidptr.swpieview/                             22-Feb-2021 12:18                   -
org.voidsink.anewjkuapp/                           22-Feb-2021 12:18                   -
org.vono.narau/                                    22-Feb-2021 12:18                   -
org.vudroid/                                       22-Feb-2021 12:18                   -
org.wahtod.wififixer/                              22-Feb-2021 12:18                   -
org.walleth/                                       22-Feb-2021 12:18                   -
org.weilbach.splitbills/                           22-Feb-2021 12:18                   -
org.wheelmap.android.online/                       22-Feb-2021 12:18                   -
org.whitequark.sipcaller/                          22-Feb-2021 12:18                   -
org.wikimedia.commons.muzei/                       22-Feb-2021 12:18                   -
org.wikimedia.commons.wikimedia/                   22-Feb-2021 12:18                   -
org.wikipedia/                                     22-Feb-2021 12:18                   -
org.wiktionary/                                    22-Feb-2021 12:18                   -
org.wingy.chan/                                    22-Feb-2021 12:18                   -
org.witness.sscphase1/                             22-Feb-2021 12:18                   -
org.woltage.irssiconnectbot/                       22-Feb-2021 12:18                   -
org.wordpress.android/                             22-Feb-2021 12:18                   -
org.wroot.android.goldeneye/                       22-Feb-2021 12:18                   -
org.xapek.andiodine/                               22-Feb-2021 12:18                   -
org.xbmc.android.remote/                           22-Feb-2021 12:18                   -
org.xbmc.kodi/                                     22-Feb-2021 12:18                   -
org.xcsoar/                                        22-Feb-2021 12:18                   -
org.xphnx.ameixa/                                  22-Feb-2021 12:18                   -
org.xphnx.iconsubmit/                              22-Feb-2021 12:18                   -
org.xposeddownloader/                              22-Feb-2021 12:18                   -
org.y20k.trackbook/                                22-Feb-2021 12:18                   -
org.y20k.transistor/                               22-Feb-2021 12:18                   -
org.yaaic/                                         22-Feb-2021 12:18                   -
org.yabause.android/                               22-Feb-2021 12:18                   -
org.yaxim.androidclient/                           22-Feb-2021 12:18                   -
org.yuttadhammo.BodhiTimer/                        22-Feb-2021 12:18                   -
org.yuttadhammo.tipitaka/                          22-Feb-2021 12:18                   -
org.zakky.memopad/                                 22-Feb-2021 12:18                   -
org.zamedev.gloomydungeons1hardcore.opensource/    22-Feb-2021 12:18                   -
org.zamedev.gloomydungeons2.opensource/            22-Feb-2021 12:18                   -
org.zeitgeist.movement/                            22-Feb-2021 12:18                   -
org.zephyrsoft.checknetwork/                       22-Feb-2021 12:18                   -
org.zephyrsoft.sdbviewer/                          22-Feb-2021 12:18                   -
org.zephyrsoft.trackworktime/                      22-Feb-2021 12:18                   -
org.zimmob.zimlx/                                  22-Feb-2021 12:18                   -
org.zirco/                                         22-Feb-2021 12:18                   -
paulscode.android.mupen64plusae/                   22-Feb-2021 12:18                   -
pc.javier.seguime/                                 22-Feb-2021 12:18                   -
peanutencryption.peanutencryption/                 22-Feb-2021 12:18                   -
pk.contender.earmouse/                             22-Feb-2021 12:18                   -
pl.hypeapp.endoscope/                              22-Feb-2021 12:18                   -
pl.hypeapp.episodie/                               22-Feb-2021 12:18                   -
pl.kuben.progressapp/                              22-Feb-2021 12:18                   -
pl.narfsoftware.thermometer/                       22-Feb-2021 12:18                   -
pl.net.szafraniec.NFCKey/                          22-Feb-2021 12:18                   -
pl.net.szafraniec.NFCTagmaker/                     22-Feb-2021 12:18                   -
pl.nkg.geokrety/                                   22-Feb-2021 12:18                   -
pl.sanszo.pcis/                                    22-Feb-2021 12:18                   -
player.efis.cfd/                                   22-Feb-2021 12:18                   -
player.efis.data.eur.rus/                          22-Feb-2021 12:18                   -
player.efis.data.pan.arg/                          22-Feb-2021 12:18                   -
player.efis.data.sah.jap/                          22-Feb-2021 12:18                   -
player.efis.data.usa.can/                          22-Feb-2021 12:18                   -
player.efis.data.zar.aus/                          22-Feb-2021 12:18                   -
player.efis.mfd/                                   22-Feb-2021 12:18                   -
player.efis.pfd/                                   22-Feb-2021 12:18                   -
press.condense.www/                                22-Feb-2021 12:18                   -
priv.twoerner.brightnesswidget/                    22-Feb-2021 12:18                   -
privacyfriendlyshoppinglist.secuso.org.privacyf..> 22-Feb-2021 12:18                   -
pro.dbro.bart/                                     22-Feb-2021 12:18                   -
pro.oneredpixel.l9droid/                           22-Feb-2021 12:18                   -
pro.rudloff.openvegemap/                           22-Feb-2021 12:18                   -
pro.rudloff.papercraft/                            22-Feb-2021 12:18                   -
protect.babymonitor/                               22-Feb-2021 12:18                   -
protect.babysleepsounds/                           22-Feb-2021 12:18                   -
protect.budgetwatch/                               22-Feb-2021 12:18                   -
protect.card_locker/                               22-Feb-2021 12:18                   -
protect.gift_card_guard/                           22-Feb-2021 12:18                   -
protect.rentalcalc/                                22-Feb-2021 12:18                   -
protect.videoeditor/                               22-Feb-2021 12:18                   -
pt.ipleiria.mymusicqoe/                            22-Feb-2021 12:18                   -
pt.isec.tp.am/                                     22-Feb-2021 12:18                   -
pt.joaomneto.titancompanion/                       22-Feb-2021 12:18                   -
pw.thedrhax.mosmetro/                              22-Feb-2021 12:18                   -
raele.concurseiro/                                 22-Feb-2021 12:18                   -
re.jcg.playmusicexporter/                          22-Feb-2021 12:18                   -
remuco.client.android/                             22-Feb-2021 12:18                   -
rino.org.tethercompanion/                          22-Feb-2021 12:18                   -
rkr.simplekeyboard.inputmethod/                    22-Feb-2021 12:18                   -
ro.ciubex.dscautorename/                           22-Feb-2021 12:18                   -
ro.ieval.fonbot/                                   22-Feb-2021 12:18                   -
ro.mihai.tpt/                                      22-Feb-2021 12:18                   -
ro.ui.pttdroid/                                    22-Feb-2021 12:18                   -
ro.weednet.contactssync/                           22-Feb-2021 12:18                   -
rocks.poopjournal.morse/                           22-Feb-2021 12:18                   -
rodrigodavy.com.github.pixelartist/                22-Feb-2021 12:18                   -
rs.pedjaapps.alogcatroot.app/                      22-Feb-2021 12:18                   -
ru.equestriadev.mgke/                              22-Feb-2021 12:18                   -
ru.exlmoto.snood21/                                22-Feb-2021 12:18                   -
ru.gelin.android.browser.open/                     22-Feb-2021 12:18                   -
ru.gelin.android.sendtosd/                         22-Feb-2021 12:18                   -
ru.gelin.android.weather.notification/             22-Feb-2021 12:18                   -
ru.gelin.android.weather.notification.skin.bigg..> 22-Feb-2021 12:18                   -
ru.gelin.android.weather.notification.skin.blac..> 22-Feb-2021 12:18                   -
ru.gelin.android.weather.notification.skin.blac..> 22-Feb-2021 12:18                   -
ru.gelin.android.weather.notification.skin.whit..> 22-Feb-2021 12:18                   -
ru.gelin.android.weather.notification.skin.whit..> 22-Feb-2021 12:18                   -
ru.henridellal.dialer/                             22-Feb-2021 12:18                   -
ru.henridellal.emerald/                            22-Feb-2021 12:18                   -
ru.henridellal.patolli/                            22-Feb-2021 12:18                   -
ru.hyst329.openfool/                               22-Feb-2021 12:18                   -
ru.ifproject.android.afr/                          22-Feb-2021 12:18                   -
ru.meefik.busybox/                                 22-Feb-2021 12:18                   -
ru.meefik.tzupdater/                               22-Feb-2021 12:18                   -
ru.moscow.tuzlukov.sergey.weatherlog/              22-Feb-2021 12:18                   -
ru.neverdark.silentnight/                          22-Feb-2021 12:18                   -
ru.o2genum.coregame/                               22-Feb-2021 12:18                   -
ru.playsoftware.j2meloader/                        22-Feb-2021 12:18                   -
ru.ra66it.updaterforspotify/                       22-Feb-2021 12:18                   -
ru.sash0k.bluetooth_terminal/                      22-Feb-2021 12:18                   -
ru.subprogram.paranoidsmsblocker/                  22-Feb-2021 12:18                   -
ru.ttyh.neko259.notey/                             22-Feb-2021 12:18                   -
ru.valle.btc/                                      22-Feb-2021 12:18                   -
ru.yanus171.feedexfork/                            22-Feb-2021 12:18                   -
ru.zxalexis.ugaday/                                22-Feb-2021 12:18                   -
ru0xdc.rtkgps/                                     22-Feb-2021 12:18                   -
ryey.camcov/                                       22-Feb-2021 12:18                   -
ryey.colorsniffer/                                 22-Feb-2021 12:18                   -
ryey.easer/                                        22-Feb-2021 12:18                   -
ryey.flock/                                        22-Feb-2021 12:18                   -
saschpe.contactevents/                             22-Feb-2021 12:18                   -
saschpe.poker/                                     22-Feb-2021 12:18                   -
science.itaintrocket.pomfshare/                    22-Feb-2021 12:18                   -
se.anyro.nfc_reader/                               22-Feb-2021 12:18                   -
se.bitcraze.crazyfliecontrol2/                     22-Feb-2021 12:18                   -
se.danielj.geometridestroyer/                      22-Feb-2021 12:18                   -
se.embargo.retroboy/                               22-Feb-2021 12:18                   -
se.erikofsweden.findmyphone/                       22-Feb-2021 12:18                   -
se.johanhil.clipboard/                             22-Feb-2021 12:18                   -
se.johanhil.duckduckgo/                            22-Feb-2021 12:18                   -
se.leap.bitmaskclient/                             22-Feb-2021 12:18                   -
se.leap.riseupvpn/                                 22-Feb-2021 12:18                   -
se.manyver/                                        22-Feb-2021 12:18                   -
se.norenh.rkfread/                                 22-Feb-2021 12:18                   -
se.oandell.riksdagen/                              22-Feb-2021 12:18                   -
se.pp.mc.android.Gerberoid/                        22-Feb-2021 12:18                   -
se.traffar.dot_race/                               22-Feb-2021 12:18                   -
se.tube42.drum.android/                            22-Feb-2021 12:18                   -
se.tube42.kidsmem.android/                         22-Feb-2021 12:18                   -
se.tube42.p9.android/                              22-Feb-2021 12:18                   -
seanfoy.wherering/                                 22-Feb-2021 12:18                   -
security.pEp/                                      22-Feb-2021 12:18                   -
sh.ftp.rocketninelabs.meditationassistant.opens..> 22-Feb-2021 12:18                   -
si.modrajagoda.didi/                               22-Feb-2021 12:18                   -
siir.es.adbWireless/                               22-Feb-2021 12:18                   -
simple.reboot.com/                                 22-Feb-2021 12:18                   -
sk.baka.aedict/                                    22-Feb-2021 12:18                   -
sk.halmi.fbeditplus/                               22-Feb-2021 12:18                   -
sk.madzik.android.logcatudp/                       22-Feb-2021 12:18                   -
sk.vx.connectbot/                                  22-Feb-2021 12:18                   -
sonoroxadc.garethmurfin.co.uk/                     22-Feb-2021 12:18                   -
sony.hidden.servicemenu/                           22-Feb-2021 12:18                   -
souch.smp/                                         22-Feb-2021 12:18                   -
souch.smsbypass/                                   22-Feb-2021 12:18                   -
space.bm835.pb/                                    22-Feb-2021 12:18                   -
space.neothefox.laytray/                           22-Feb-2021 12:18                   -
starcom.snd/                                       22-Feb-2021 12:18                   -
steele.gerry.dotty/                                22-Feb-2021 12:18                   -
sterrenburg.github.flutterhole/                    22-Feb-2021 12:18                   -
streetwalrus.usbmountr/                            22-Feb-2021 12:18                   -
subreddit.android.appstore/                        22-Feb-2021 12:18                   -
sun.bob.leela/                                     22-Feb-2021 12:18                   -
swati4star.createpdf/                              22-Feb-2021 12:18                   -
systems.byteswap.aiproute/                         22-Feb-2021 12:18                   -
szelok.app.twister/                                22-Feb-2021 12:18                   -
taco.apkmirror/                                    22-Feb-2021 12:18                   -
team.swing.pendulums/                              22-Feb-2021 12:18                   -
teamunguided.brighttime/                           22-Feb-2021 12:18                   -
teaonly.droideye/                                  22-Feb-2021 12:18                   -
tech.ula/                                          22-Feb-2021 12:18                   -
telegra.ph/                                        22-Feb-2021 12:18                   -
tf.nox.wifisetup/                                  22-Feb-2021 12:18                   -
theakki.synctool/                                  22-Feb-2021 12:18                   -
theredspy15.ltecleanerfoss/                        22-Feb-2021 12:18                   -
threads.server/                                    22-Feb-2021 12:18                   -
tk.al54.dev.badpixels/                             22-Feb-2021 12:18                   -
tk.elevenk.dailybread/                             22-Feb-2021 12:18                   -
tk.giesecke.painlessmesh/                          22-Feb-2021 12:18                   -
tk.giesecke.phoenix/                               22-Feb-2021 12:18                   -
tk.jordynsmediagroup.simpleirc.fdroid/             22-Feb-2021 12:18                   -
tk.radioactivemineral.metronome/                   22-Feb-2021 12:18                   -
tk.superl2.xwifi/                                  22-Feb-2021 12:18                   -
tkj.android.homecontrol.mythmote/                  22-Feb-2021 12:18                   -
tmendes.com.analyticalbalancedroid/                22-Feb-2021 12:18                   -
to.networld.android.divedroid/                     22-Feb-2021 12:18                   -
tomer.com.alwaysonamoledplugin/                    22-Feb-2021 12:18                   -
tranquvis.simplesmsremote/                         22-Feb-2021 12:18                   -
trikita.obsqr/                                     22-Feb-2021 12:18                   -
trikita.slide/                                     22-Feb-2021 12:18                   -
trikita.talalarmo/                                 22-Feb-2021 12:18                   -
tritop.android.SLWTrafficMeterWidget/              22-Feb-2021 12:18                   -
tritop.androidSLWCpuWidget/                        22-Feb-2021 12:18                   -
troop.com.freedcam/                                22-Feb-2021 12:18                   -
tuioDroid.impl/                                    22-Feb-2021 12:18                   -
tv.piratemedia.lightcontroler/                     22-Feb-2021 12:18                   -
tw.com.daxia.virtualsoftkeys/                      22-Feb-2021 12:18                   -
tw.qtlin.mac.airunlocker/                          22-Feb-2021 12:18                   -
tyagi.shubham.customsearch/                        22-Feb-2021 12:18                   -
uk.ac.cam.cl.dtg.android.barcodebox/               22-Feb-2021 12:18                   -
uk.ac.ed.inf.mandelbrotmaps/                       22-Feb-2021 12:18                   -
uk.ac.swansea.eduroamcat/                          22-Feb-2021 12:18                   -
uk.co.ashtonbrsc.android.intentintercept/          22-Feb-2021 12:18                   -
uk.co.bitethebullet.android.token/                 22-Feb-2021 12:18                   -
uk.co.busydoingnothing.catverbs/                   22-Feb-2021 12:18                   -
uk.co.busydoingnothing.prevo/                      22-Feb-2021 12:18                   -
uk.co.danieljarvis.android.flashback/              22-Feb-2021 12:18                   -
uk.co.jarofgreen.JustADamnCompass/                 22-Feb-2021 12:18                   -
uk.co.keepawayfromfire.screens/                    22-Feb-2021 12:18                   -
uk.co.richyhbm.monochromatic/                      22-Feb-2021 12:18                   -
uk.co.yahoo.p1rpp.calendartrigger/                 22-Feb-2021 12:18                   -
uk.org.boddie.android.weatherforecast/             22-Feb-2021 12:18                   -
uk.org.cardboardbox.wonderdroid/                   22-Feb-2021 12:18                   -
uk.org.crimetalk/                                  22-Feb-2021 12:18                   -
unisiegen.photographers.activity/                  22-Feb-2021 12:18                   -
uobikiemukot.yaft/                                 22-Feb-2021 12:18                   -
urbanstew.RehearsalAssistant/                      22-Feb-2021 12:18                   -
us.achromaticmetaphor.agram/                       22-Feb-2021 12:18                   -
us.achromaticmetaphor.imcktg/                      22-Feb-2021 12:18                   -
us.bravender.android.dongsa/                       22-Feb-2021 12:18                   -
us.feras.mdv.demo/                                 22-Feb-2021 12:18                   -
us.koller.cameraroll/                              22-Feb-2021 12:18                   -
us.lindanrandy.cidrcalculator/                     22-Feb-2021 12:18                   -
us.shandian.giga/                                  22-Feb-2021 12:18                   -
ut.ewh.audiometrytest/                             22-Feb-2021 12:18                   -
vik.linx.stormify/                                 22-Feb-2021 12:18                   -
vnd.blueararat.kaleidoscope6/                      22-Feb-2021 12:18                   -
vu.de.urpool.quickdroid/                           22-Feb-2021 12:18                   -
wb.receiptspro/                                    22-Feb-2021 12:18                   -
wiseguys.radar/                                    22-Feb-2021 12:18                   -
wseemann.media.romote/                             22-Feb-2021 12:18                   -
x1125io.initdlight/                                22-Feb-2021 12:18                   -
x653.bullseye/                                     22-Feb-2021 12:18                   -
xyz.hisname.fireflyiii/                            22-Feb-2021 12:18                   -
xyz.iridiumion.plucklockex/                        22-Feb-2021 12:18                   -
yellr.net.yellr_android/                           22-Feb-2021 12:18                   -
ymakei.vegetarian_journal/                         22-Feb-2021 12:18                   -
youten.redo.ble.ibeacondetector/                   22-Feb-2021 12:18                   -
z4pp3r.flashlightwidget/                           22-Feb-2021 12:18                   -
za.co.lukestonehm.logicaldefence/                  22-Feb-2021 12:18                   -
za.co.neilson.alarm/                               22-Feb-2021 12:18                   -
zame.GloomyDungeons.opensource.game/               22-Feb-2021 12:18                   -
zen.meditation.android/                            22-Feb-2021 12:18                   -
An.stop.yml                                        22-Feb-2021 12:18                 612
SpeedoMeterApp.main.yml                            22-Feb-2021 12:18                 466
a2dp.Vol.yml                                       22-Feb-2021 12:18                5915
aarddict.android.yml                               22-Feb-2021 12:18                2534
ac.robinson.mediaphone.yml                         22-Feb-2021 12:18                1029
acr.browser.barebones.yml                          22-Feb-2021 12:18                2850
acr.browser.lightning.yml                          22-Feb-2021 12:18                4707
ademar.bitac.yml                                   22-Feb-2021 12:18                 503
agersant.polaris.yml                               22-Feb-2021 12:18                 789
agrigolo.chubbyclick.yml                           22-Feb-2021 12:18                1428
ai.susi.yml                                        22-Feb-2021 12:18                2306
akk.astro.droid.moonphase.yml                      22-Feb-2021 12:18                 818
am.ed.exportcontacts.yml                           22-Feb-2021 12:18                 954
am.ed.importcontacts.yml                           22-Feb-2021 12:18                1083
am.zoom.mbrowser.yml                               22-Feb-2021 12:18                 775
am.zoom.mlauncher.yml                              22-Feb-2021 12:18                 764
amirz.dngprocessor.yml                             22-Feb-2021 12:18                 792
amirz.rootless.nexuslauncher.yml                   22-Feb-2021 12:18                1315
androdns.android.leetdreams.ch.androdns.yml        22-Feb-2021 12:18                3281
android.androidVNC.yml                             22-Feb-2021 12:18                1010
android.game.prboom.yml                            22-Feb-2021 12:18                1060
android.jonas.fakestandby.yml                      22-Feb-2021 12:18                1026
android.nachiketa.ebookdownloader.yml              22-Feb-2021 12:18                1420
android.tether.yml                                 22-Feb-2021 12:18                1269
anupam.acrylic.yml                                 22-Feb-2021 12:18                2191
app.crescentcash.src.yml                           22-Feb-2021 12:18                1668
app.easytoken.yml                                  22-Feb-2021 12:18                2078
app.fedilab.fedilabtube.yml                        22-Feb-2021 12:18                3390
app.fedilab.lite.yml                               22-Feb-2021 12:18                1613
app.fedilab.mobilizon.yml                          22-Feb-2021 12:18                 839
app.fedilab.nitterizeme.yml                        22-Feb-2021 12:18                3445
app.fedilab.nitterizemelite.yml                    22-Feb-2021 12:18                2151
app.fedilab.openmaps.yml                           22-Feb-2021 12:18                1099
app.fedilab.tubelab.yml                            22-Feb-2021 12:18                2893
app.fyreplace.client.yml                           22-Feb-2021 12:18                7876
app.librenews.io.librenews.yml                     22-Feb-2021 12:18                2249
app.olauncher.yml                                  22-Feb-2021 12:18                2320
app.openconnect.yml                                22-Feb-2021 12:18                4661
app.pott.kaffeepott.androidclient.yml              22-Feb-2021 12:18                 531
app.reading.stoic.stoicreading.yml                 22-Feb-2021 12:18                4538
app.varlorg.unote.yml                              22-Feb-2021 12:18                2999
app.zeusln.zeus.yml                                22-Feb-2021 12:18                2518
apps.amine.bou.readerforselfoss.yml                22-Feb-2021 12:18               10805
apps.babycaretimer.yml                             22-Feb-2021 12:18                 711
apps.droidnotify.yml                               22-Feb-2021 12:18                5464
apps.jizzu.simpletodo.yml                          22-Feb-2021 12:18                1248
aq.com.sharetobrowser.yml                          22-Feb-2021 12:18                 521
aq.metallists.loudbang.yml                         22-Feb-2021 12:18                 605
ar.com.tristeslostrestigres.diasporanativewebap..> 22-Feb-2021 12:18                2563
ar.com.tristeslostrestigres.redpanal.yml           22-Feb-2021 12:18                 855
ar.rulosoft.mimanganu.yml                          22-Feb-2021 12:18               43784
arity.calculator.yml                               22-Feb-2021 12:18                 488
at.bitfire.cadroid.yml                             22-Feb-2021 12:18                2019
at.bitfire.davdroid.yml                            22-Feb-2021 12:18               27299
at.bitfire.devicelocator.yml                       22-Feb-2021 12:18                 573
at.bitfire.gfxtablet.yml                           22-Feb-2021 12:18                1968
at.bitfire.icsdroid.yml                            22-Feb-2021 12:18                4301
at.bitfire.nophonespam.yml                         22-Feb-2021 12:18                2685
at.dasz.KolabDroid.yml                             22-Feb-2021 12:18                1046
at.fhhgb.mc.swip.yml                               22-Feb-2021 12:18                1406
at.h4x.awhip.yml                                   22-Feb-2021 12:18                 646
at.h4x.metaapp.yml                                 22-Feb-2021 12:18                1309
at.jclehner.rxdroid.yml                            22-Feb-2021 12:18                1713
at.linuxtage.companion.yml                         22-Feb-2021 12:18                2751
at.or.at.plugoffairplane.yml                       22-Feb-2021 12:18                1173
at.tacticaldevc.panictrigger.yml                   22-Feb-2021 12:18                2004
at.tomtasche.reader.yml                            22-Feb-2021 12:18                7120
at.univie.sensorium.yml                            22-Feb-2021 12:18                2066
at.weiss.matthias.musicala.yml                     22-Feb-2021 12:18                 948
at.zweng.bankomatinfos.yml                         22-Feb-2021 12:18                1806
at.zweng.bankomatinfos2.yml                        22-Feb-2021 12:18                1640
atitel.com.todoer.yml                              22-Feb-2021 12:18                 731
atm.nasaimages.yml                                 22-Feb-2021 12:18                 998
atm.rocketguardian.yml                             22-Feb-2021 12:18                 850
atm.starun.game.yml                                22-Feb-2021 12:18                1286
au.com.darkside.XServer.yml                        22-Feb-2021 12:18                2292
au.com.darkside.xdemo.yml                          22-Feb-2021 12:18                1104
au.com.wallaceit.reddinator.yml                    22-Feb-2021 12:18               11245
au.id.micolous.farebot.yml                         22-Feb-2021 12:18                3354
awais.instagrabber.yml                             22-Feb-2021 12:18                3144
aws.apps.androidDrawables.yml                      22-Feb-2021 12:18                1814
aws.apps.usbDeviceEnumerator.yml                   22-Feb-2021 12:18                1207
axp.tool.apkextractor.yml                          22-Feb-2021 12:18                1382
bander.notepad.yml                                 22-Feb-2021 12:18                 486
be.ac.ulb.lisa.idot.android.dicomviewer.yml        22-Feb-2021 12:18                 712
be.brunoparmentier.apkshare.yml                    22-Feb-2021 12:18                 833
be.brunoparmentier.dnssetter.yml                   22-Feb-2021 12:18                1360
be.brunoparmentier.openbikesharing.app.yml         22-Feb-2021 12:18                4118
be.brunoparmentier.wifikeyshare.yml                22-Feb-2021 12:18                2006
be.digitalia.fosdem.yml                            22-Feb-2021 12:18                4484
be.geecko.QuickLyric.yml                           22-Feb-2021 12:18                2304
be.humanoids.webthingify.yml                       22-Feb-2021 12:18                 616
be.lionslink.ucllstudent.yml                       22-Feb-2021 12:18                1489
be.mygod.vpnhotspot.yml                            22-Feb-2021 12:18                9141
be.norio.randomapp.yml                             22-Feb-2021 12:18                 778
be.ppareit.shutdown.yml                            22-Feb-2021 12:18                1008
be.ppareit.swiftp_free.yml                         22-Feb-2021 12:18                6576
be.quentinloos.manille.yml                         22-Feb-2021 12:18                 906
be.uhasselt.privacypolice.yml                      22-Feb-2021 12:18                2651
biz.codefuture.svgviewer.yml                       22-Feb-2021 12:18                 803
biz.gyrus.yaab.yml                                 22-Feb-2021 12:18                1801
br.com.dgimenes.nasapic.yml                        22-Feb-2021 12:18                2766
br.com.frs.foodrestrictions.yml                    22-Feb-2021 12:18                1953
br.com.gualandi.dailypill.yml                      22-Feb-2021 12:18                 551
br.odb.knights.yml                                 22-Feb-2021 12:18                1217
br.usp.ime.retrobreaker.yml                        22-Feb-2021 12:18                1344
btools.routingapp.yml                              22-Feb-2021 12:18                4539
budo.budoist.yml                                   22-Feb-2021 12:18                2006
buet.rafi.dictionary.yml                           22-Feb-2021 12:18                 686
bughunter2.smsfilter.yml                           22-Feb-2021 12:18                1431
bus.chio.wishmaster.yml                            22-Feb-2021 12:18                1746
by.yauhenl.gardine.yml                             22-Feb-2021 12:18                 781
byrne.utilities.converter.yml                      22-Feb-2021 12:18                 840
byrne.utilities.hashpass.yml                       22-Feb-2021 12:18                 822
byrne.utilities.pasteedroid.yml                    22-Feb-2021 12:18                 670
ca.andries.portknocker.yml                         22-Feb-2021 12:18                 573
ca.chancehorizon.paseo.yml                         22-Feb-2021 12:18                 578
ca.cmetcalfe.locationshare.yml                     22-Feb-2021 12:18                2074
ca.cmetcalfe.xposed.disablebatterywarnings.yml     22-Feb-2021 12:18                1028
ca.cmetcalfe.xposed.flatconnectivityicons.yml      22-Feb-2021 12:18                 861
ca.ddaly.android.heart.yml                         22-Feb-2021 12:18                 964
ca.farrelltonsolar.classic.yml                     22-Feb-2021 12:18                3359
ca.littlesvr.everyonestimetable.yml                22-Feb-2021 12:18                 604
ca.mimic.apphangar.yml                             22-Feb-2021 12:18                2032
ca.momi.lift.yml                                   22-Feb-2021 12:18                 599
ca.mudar.fairphone.peaceofmind.yml                 22-Feb-2021 12:18                2880
ca.pr0ps.xposed.entrustunblocker.yml               22-Feb-2021 12:18                1620
ca.rmen.android.frenchcalendar.yml                 22-Feb-2021 12:18                6399
ca.rmen.android.networkmonitor.yml                 22-Feb-2021 12:18                7256
ca.rmen.android.poetassistant.yml                  22-Feb-2021 12:18                9836
ca.rmen.android.scrumchatter.yml                   22-Feb-2021 12:18                3642
ca.rmen.nounours.yml                               22-Feb-2021 12:18                3957
ca.snoe.deedum.yml                                 22-Feb-2021 12:18                 848
caldwell.ben.bites.yml                             22-Feb-2021 12:18                1030
caldwell.ben.trolly.yml                            22-Feb-2021 12:18                 913
campyre.android.yml                                22-Feb-2021 12:18                 529
cat.jordihernandez.cinecat.yml                     22-Feb-2021 12:18                1092
cat.mvmike.minimalcalendarwidget.yml               22-Feb-2021 12:18                2864
cat.pantsu.nyaapantsu.yml                          22-Feb-2021 12:18                 859
cc.calliope.mini.yml                               22-Feb-2021 12:18                 839
cc.co.eurdev.urecorder.yml                         22-Feb-2021 12:18                 577
cc.echonet.coolmicapp.yml                          22-Feb-2021 12:18                2088
cc.rainwave.android.yml                            22-Feb-2021 12:18                1641
cf.fridays.fff_info.yml                            22-Feb-2021 12:18                1471
cgeo.geocaching.yml                                22-Feb-2021 12:18                3447
ch.abertschi.adfree.yml                            22-Feb-2021 12:18                2373
ch.bailu.aat.yml                                   22-Feb-2021 12:18                3489
ch.blinkenlights.android.apnswitch.yml             22-Feb-2021 12:18                 672
ch.blinkenlights.android.vanilla.yml               22-Feb-2021 12:18                6594
ch.blinkenlights.android.vanillaplug.yml           22-Feb-2021 12:18                1421
ch.blinkenlights.battery.yml                       22-Feb-2021 12:18                 916
ch.citux.td.yml                                    22-Feb-2021 12:18                 648
ch.corten.aha.worldclock.yml                       22-Feb-2021 12:18                4402
ch.cryptobit.letterbox.yml                         22-Feb-2021 12:18                 461
ch.deletescape.lawnchair.plah.yml                  22-Feb-2021 12:18                6148
ch.dissem.android.drupal.yml                       22-Feb-2021 12:18                 747
ch.famoser.mensa.yml                               22-Feb-2021 12:18                 518
ch.fixme.cowsay.yml                                22-Feb-2021 12:18                1042
ch.fixme.status.yml                                22-Feb-2021 12:18                1311
ch.gassenarbeit.bern.your.rights.yml               22-Feb-2021 12:18                1259
ch.hgdev.toposuite.yml                             22-Feb-2021 12:18                3033
ch.hsr.eyecam.yml                                  22-Feb-2021 12:18                 981
ch.ihdg.calendarcolor.yml                          22-Feb-2021 12:18                1455
ch.jiikuy.velocitycalculator.yml                   22-Feb-2021 12:18                1420
ch.logixisland.anuto.yml                           22-Feb-2021 12:18                2625
ch.nexuscomputing.android.osciprimeics.yml         22-Feb-2021 12:18                 797
ch.protonvpn.android.yml                           22-Feb-2021 12:18               17217
ch.rmy.android.http_shortcuts.yml                  22-Feb-2021 12:18                2134
ch.rmy.android.statusbar_tacho.yml                 22-Feb-2021 12:18                 966
ch.rrelmy.android.batterymanager.yml               22-Feb-2021 12:18                 550
ch.rrelmy.android.locationcachemap.yml             22-Feb-2021 12:18                1299
ch.seto.kanjirecog.yml                             22-Feb-2021 12:18                 455
ch.thgoebel.spartathlonapp.yml                     22-Feb-2021 12:18                2792
chat.rocket.android.yml                            22-Feb-2021 12:18                9358
chromiumupdater.bamless.com.chromiumsweupdater.yml 22-Feb-2021 12:18                1523
cityfreqs.com.pilfershushjammer.yml                22-Feb-2021 12:18                5078
cl.coders.faketraveler.yml                         22-Feb-2021 12:18                1229
click.dummer.UartSmartwatch.yml                    22-Feb-2021 12:18                2959
click.dummer.funphonepuppet.yml                    22-Feb-2021 12:18                 490
click.dummer.have_radiosion.yml                    22-Feb-2021 12:18                1575
click.dummer.imagesms.yml                          22-Feb-2021 12:18                1365
click.dummer.notify_to_jabber.yml                  22-Feb-2021 12:18                1405
click.dummer.rickapp.yml                           22-Feb-2021 12:18                1746
click.dummer.textthing.yml                         22-Feb-2021 12:18                2619
click.dummer.yidkey.yml                            22-Feb-2021 12:18                 713
co.appreactor.news.yml                             22-Feb-2021 12:18                1061
co.epitre.aelf_lectures.yml                        22-Feb-2021 12:18                3971
co.garmax.materialflashlight.yml                   22-Feb-2021 12:18                1046
co.loubo.icicle.yml                                22-Feb-2021 12:18                 877
co.prestosole.clima.yml                            22-Feb-2021 12:18                1440
co.pxhouse.sas.yml                                 22-Feb-2021 12:18                1312
co.timsmart.vouchervault.yml                       22-Feb-2021 12:18                2412
com.Bisha.TI89EmuDonation.yml                      22-Feb-2021 12:18                 960
com.DartChecker.yml                                22-Feb-2021 12:18                2000
com.EthanHeming.NeuralNetworkSimulator.yml         22-Feb-2021 12:18                 748
com.FireFart.Permissions2.yml                      22-Feb-2021 12:18                 679
com.GTP.eveminer.yml                               22-Feb-2021 12:18                1019
com.LAPARCELA.nihonoari.yml                        22-Feb-2021 12:18                2426
com.MarcosDiez.shareviahttp.yml                    22-Feb-2021 12:18                2864
com.Pau.ImapNotes2.yml                             22-Feb-2021 12:18                1215
com.SecUpwN.AIMSICD.yml                            22-Feb-2021 12:18                6072
com.Sommerlichter.social.yml                       22-Feb-2021 12:18                 919
com.a5corp.weather.yml                             22-Feb-2021 12:18                2005
com.aa.mynotes.yml                                 22-Feb-2021 12:18                 643
com.aaronhalbert.nosurfforreddit.yml               22-Feb-2021 12:18                 886
com.aaronjwood.portauthority.yml                   22-Feb-2021 12:18                9508
com.abast.homebot.yml                              22-Feb-2021 12:18                 825
com.abcdjdj.rootverifier.yml                       22-Feb-2021 12:18                1286
com.abhijitvalluri.android.fitnotifications.yml    22-Feb-2021 12:18                1353
com.abhinavmarwaha.curator.yml                     22-Feb-2021 12:18                1674
com.abhinavmarwaha.wrotto.yml                      22-Feb-2021 12:18                1370
com.abitsinc.andr.yml                              22-Feb-2021 12:18                1104
com.achep.acdisplay.yml                            22-Feb-2021 12:18                8995
com.achep.widget.jellyclock.yml                    22-Feb-2021 12:18                 845
com.actisec.clipcaster.yml                         22-Feb-2021 12:18                1022
com.acvarium.tasclock.yml                          22-Feb-2021 12:18                 841
com.adam.aslfms.yml                                22-Feb-2021 12:18                3156
com.addi.yml                                       22-Feb-2021 12:18                 981
com.adgad.kboard.yml                               22-Feb-2021 12:18                 452
com.adguard.android.contentblocker.yml             22-Feb-2021 12:18                2135
com.adityakamble49.dcipher.yml                     22-Feb-2021 12:18                1543
com.adonai.manman.yml                              22-Feb-2021 12:18                3399
com.adrienpoupa.attestationcoronavirus.yml         22-Feb-2021 12:18                1026
com.adstrosoftware.launchappops.yml                22-Feb-2021 12:18                 739
com.aefyr.sai.fdroid.yml                           22-Feb-2021 12:18                7741
com.afollestad.cabinet.yml                         22-Feb-2021 12:18                6487
com.afollestad.impression.yml                      22-Feb-2021 12:18                1573
com.afollestad.nocknock.yml                        22-Feb-2021 12:18                1349
com.agateau.catgenerator.yml                       22-Feb-2021 12:18                 964
com.agateau.tinywheels.android.yml                 22-Feb-2021 12:18                5818
com.agnibho.android.solarcompass.yml               22-Feb-2021 12:18                1389
com.ahorcado.yml                                   22-Feb-2021 12:18                 778
com.aidinhut.simpletextcrypt.yml                   22-Feb-2021 12:18                2056
com.akdev.nofbeventscraper.yml                     22-Feb-2021 12:18                1297
com.akop.bach.yml                                  22-Feb-2021 12:18                1087
com.alaskalinuxuser.criticalvelocity.yml           22-Feb-2021 12:18                1339
com.alaskalinuxuser.hourglass.yml                  22-Feb-2021 12:18                1711
com.alaskalinuxuser.justchess.yml                  22-Feb-2021 12:18                1100
com.alaskalinuxuser.justcraigslist.yml             22-Feb-2021 12:18                1828
com.alaskalinuxuser.justnotes.yml                  22-Feb-2021 12:18                2591
com.alaskalinuxuser.rilcontrol.yml                 22-Feb-2021 12:18                 912
com.alaskalinuxuser.shipcaptainandcrew.yml         22-Feb-2021 12:18                1930
com.alexcruz.papuhwalls.yml                        22-Feb-2021 12:18                 967
com.alexkang.bluechat.yml                          22-Feb-2021 12:18                 645
com.alexkang.loopboard.yml                         22-Feb-2021 12:18                2936
com.alexkang.x3matrixcalculator.yml                22-Feb-2021 12:18                 777
com.alexxz.hawkingquotes.yml                       22-Feb-2021 12:18                 857
com.alfray.asqare.yml                              22-Feb-2021 12:18                 927
com.alfray.mandelbrot2.yml                         22-Feb-2021 12:18                 811
com.alfray.timeriffic.yml                          22-Feb-2021 12:18                 810
com.alienpants.leafpicrevived.yml                  22-Feb-2021 12:18                1731
com.allansimon.verbisteandroid.yml                 22-Feb-2021 12:18                1078
com.altillimity.satpredict.yml                     22-Feb-2021 12:18                 932
com.alxgnon.postwriter.yml                         22-Feb-2021 12:18                1043
com.amabyte.vtucslabmanual.yml                     22-Feb-2021 12:18                1202
com.amaze.filemanager.yml                          22-Feb-2021 12:18                9385
com.ames.books.yml                                 22-Feb-2021 12:18                2074
com.amphoras.tpthelper.yml                         22-Feb-2021 12:18                1506
com.ancantus.HYPNOTOAD.yml                         22-Feb-2021 12:18                 414
com.anddevw.getchromium.yml                        22-Feb-2021 12:18                2736
com.andreasgift.totalzero.yml                      22-Feb-2021 12:18                 902
com.andrew.apollo.yml                              22-Feb-2021 12:18                1043
com.andrewshu.android.reddit.yml                   22-Feb-2021 12:18                2168
com.android.adbkeyboard.yml                        22-Feb-2021 12:18                 652
com.android.gpstest.osmdroid.yml                   22-Feb-2021 12:18               11726
com.android.inputmethod.norwegian.yml              22-Feb-2021 12:18                 694
com.android.keepass.yml                            22-Feb-2021 12:18                9520
com.android.launcher3.yml                          22-Feb-2021 12:18                1152
com.android.music.yml                              22-Feb-2021 12:18                1193
com.android.quake.yml                              22-Feb-2021 12:18                 917
com.android.shellms.yml                            22-Feb-2021 12:18                1453
com.android.talkback.yml                           22-Feb-2021 12:18                1352
com.android.todolist.yml                           22-Feb-2021 12:18                 631
com.android2.calculator3.yml                       22-Feb-2021 12:18                7105
com.androidemu.gba.yml                             22-Feb-2021 12:18                 865
com.androidemu.gbc.yml                             22-Feb-2021 12:18                 777
com.androidemu.nes.yml                             22-Feb-2021 12:18                1032
com.androidfromfrankfurt.workingtimealert.yml      22-Feb-2021 12:18                 923
com.androsz.electricsleepbeta.yml                  22-Feb-2021 12:18                1158
com.androzic.yml                                   22-Feb-2021 12:18                3913
com.andybotting.tramhunter.yml                     22-Feb-2021 12:18                2856
com.angryburg.uapp.yml                             22-Feb-2021 12:18                2202
com.angrydoughnuts.android.alarmclock.yml          22-Feb-2021 12:18                1316
com.anoopknr.pastebin.yml                          22-Feb-2021 12:18                 950
com.anoshenko.android.mahjongg.yml                 22-Feb-2021 12:18                 617
com.anpmech.launcher.yml                           22-Feb-2021 12:18                 761
com.anthony.deepl.openl.yml                        22-Feb-2021 12:18                2005
com.antoniotari.reactiveampacheapp.yml             22-Feb-2021 12:18                9841
com.antony.muzei.pixiv.yml                         22-Feb-2021 12:18                1874
com.anysoftkeyboard.languagepack.SSH.yml           22-Feb-2021 12:18                1883
com.anysoftkeyboard.languagepack.afrikaans.yml     22-Feb-2021 12:18                1191
com.anysoftkeyboard.languagepack.basque.yml        22-Feb-2021 12:18                1525
com.anysoftkeyboard.languagepack.brazilian.yml     22-Feb-2021 12:18                1356
com.anysoftkeyboard.languagepack.catalan.yml       22-Feb-2021 12:18                1534
com.anysoftkeyboard.languagepack.danish.yml        22-Feb-2021 12:18                1469
com.anysoftkeyboard.languagepack.dutch.yml         22-Feb-2021 12:18                1876
com.anysoftkeyboard.languagepack.esperanto.yml     22-Feb-2021 12:18                1373
com.anysoftkeyboard.languagepack.french.yml        22-Feb-2021 12:18                1300
com.anysoftkeyboard.languagepack.french_xlarge.yml 22-Feb-2021 12:18                1588
com.anysoftkeyboard.languagepack.galician.yml      22-Feb-2021 12:18                1222
com.anysoftkeyboard.languagepack.georgian.fdroi..> 22-Feb-2021 12:18                2716
com.anysoftkeyboard.languagepack.german.yml        22-Feb-2021 12:18                1485
com.anysoftkeyboard.languagepack.greek.yml         22-Feb-2021 12:18                1545
com.anysoftkeyboard.languagepack.hebrew.yml        22-Feb-2021 12:18                1433
com.anysoftkeyboard.languagepack.hebrew_large.yml  22-Feb-2021 12:18                1576
com.anysoftkeyboard.languagepack.hungarian.yml     22-Feb-2021 12:18                2389
com.anysoftkeyboard.languagepack.icelandic.yml     22-Feb-2021 12:18                1027
com.anysoftkeyboard.languagepack.indonesian.yml    22-Feb-2021 12:18                1053
com.anysoftkeyboard.languagepack.italian.yml       22-Feb-2021 12:18                1065
com.anysoftkeyboard.languagepack.latvian.yml       22-Feb-2021 12:18                1065
com.anysoftkeyboard.languagepack.macedonian.yml    22-Feb-2021 12:18                1221
com.anysoftkeyboard.languagepack.malayalam.yml     22-Feb-2021 12:18                1164
com.anysoftkeyboard.languagepack.neo.yml           22-Feb-2021 12:18                1330
com.anysoftkeyboard.languagepack.norwegian.yml     22-Feb-2021 12:18                1518
com.anysoftkeyboard.languagepack.osspolish.yml     22-Feb-2021 12:18                1029
com.anysoftkeyboard.languagepack.ossturkish.yml    22-Feb-2021 12:18                1033
com.anysoftkeyboard.languagepack.pali.yml          22-Feb-2021 12:18                2025
com.anysoftkeyboard.languagepack.persian.yml       22-Feb-2021 12:18                1543
com.anysoftkeyboard.languagepack.portuguese.yml    22-Feb-2021 12:18                1341
com.anysoftkeyboard.languagepack.russian2.yml      22-Feb-2021 12:18                2279
com.anysoftkeyboard.languagepack.slovene.yml       22-Feb-2021 12:18                1276
com.anysoftkeyboard.languagepack.spain.yml         22-Feb-2021 12:18                3099
com.anysoftkeyboard.languagepack.swedish.yml       22-Feb-2021 12:18                1062
com.anysoftkeyboard.languagepack.tatar.yml         22-Feb-2021 12:18                 933
com.anysoftkeyboard.languagepack.ukrainian.yml     22-Feb-2021 12:18                1800
com.anysoftkeyboard.theme.classic_pc.yml           22-Feb-2021 12:18                 908
com.aokp.backup.yml                                22-Feb-2021 12:18                1246
com.apozas.contactdiary.yml                        22-Feb-2021 12:18                2159
com.app.Zensuren.yml                               22-Feb-2021 12:18                 875
com.app.missednotificationsreminder.yml            22-Feb-2021 12:18                2788
com.app2go.sudokufree.yml                          22-Feb-2021 12:18                 901
com.appengine.paranoid_android.lost.yml            22-Feb-2021 12:18                 927
com.apps.adrcotfas.goodtime.yml                    22-Feb-2021 12:18                4300
com.appspot.usbhidterminal.yml                     22-Feb-2021 12:18                 730
com.aptasystems.dicewarepasswordgenerator.yml      22-Feb-2021 12:18                1130
com.aragaer.jtt.yml                                22-Feb-2021 12:18                1433
com.arduia.expense.yml                             22-Feb-2021 12:18                 867
com.aripuca.tracker.yml                            22-Feb-2021 12:18                2079
com.ariwilson.seismowallpaper.yml                  22-Feb-2021 12:18                 643
com.arnaud.metronome.yml                           22-Feb-2021 12:18                1503
com.artifex.mupdf.mini.app.yml                     22-Feb-2021 12:18                5556
com.artifex.mupdf.mini.yml                         22-Feb-2021 12:18                2309
com.artifex.mupdf.viewer.app.yml                   22-Feb-2021 12:18                5414
com.artifex.mupdfdemo.yml                          22-Feb-2021 12:18               12176
com.as.anagramsolver.yml                           22-Feb-2021 12:18                4300
com.asdoi.gymwen.yml                               22-Feb-2021 12:18                1701
com.asdoi.mebis.yml                                22-Feb-2021 12:18                 729
com.asdoi.quicktiles.yml                           22-Feb-2021 12:18                 685
com.asdoi.timetable.yml                            22-Feb-2021 12:18                1112
com.aselalee.trainschedule.yml                     22-Feb-2021 12:18                1802
com.asksven.betterbatterystats.yml                 22-Feb-2021 12:18                5407
com.asksven.betterwifionoff.yml                    22-Feb-2021 12:18                1146
com.atelieryl.wonderdroid.yml                      22-Feb-2021 12:18                1614
com.ath0.rpn.yml                                   22-Feb-2021 12:18                1175
com.atop.yml                                       22-Feb-2021 12:18                1062
com.atr.tedit.yml                                  22-Feb-2021 12:18                2270
com.aurora.adroid.yml                              22-Feb-2021 12:18                1502
com.aurora.corona.yml                              22-Feb-2021 12:18                1091
com.aurora.store.yml                               22-Feb-2021 12:18                3244
com.averi.worldscribe.yml                          22-Feb-2021 12:18                4225
com.axelby.podax.yml                               22-Feb-2021 12:18                4334
com.b44t.messenger.yml                             22-Feb-2021 12:18               37096
com.bald.uriah.baldphone.yml                       22-Feb-2021 12:18                2759
com.banasiak.coinflip.yml                          22-Feb-2021 12:18                1420
com.banasiak.coinflipext.example.yml               22-Feb-2021 12:18                 789
com.bd.gitlab.yml                                  22-Feb-2021 12:18                1858
com.bec3.diolite.yml                               22-Feb-2021 12:18                1772
com.bec3.mobilite.yml                              22-Feb-2021 12:18                1730
com.beckhamd.nasaimageryfetcher.yml                22-Feb-2021 12:18                 534
com.beem.project.beem.yml                          22-Feb-2021 12:18                1283
com.beemdevelopment.aegis.yml                      22-Feb-2021 12:18                2854
com.benny.openlauncher.yml                         22-Feb-2021 12:18                5008
com.bernaferrari.changedetection.yml               22-Feb-2021 12:18                1294
com.bernaferrari.sdkmonitor.yml                    22-Feb-2021 12:18                 928
com.better.alarm.yml                               22-Feb-2021 12:18                3056
com.bigbluecup.android.launcher.yml                22-Feb-2021 12:18                1752
com.biglybt.android.client.yml                     22-Feb-2021 12:18                5313
com.bijoysingh.quicknote.yml                       22-Feb-2021 12:18                3331
com.blanyal.remindly.yml                           22-Feb-2021 12:18                 580
com.bleyl.recurrence.yml                           22-Feb-2021 12:18                2219
com.blippex.app.yml                                22-Feb-2021 12:18                 701
com.blntsoft.emailpopup.yml                        22-Feb-2021 12:18                 794
com.blockbasti.justanotherworkouttimer.yml         22-Feb-2021 12:18                3094
com.blogspot.developersu.ns_usbloader.yml          22-Feb-2021 12:18                 683
com.blogspot.e_kanivets.moneytracker.yml           22-Feb-2021 12:18                1069
com.blogspot.tonyatkins.freespeech.yml             22-Feb-2021 12:18                1448
com.bmco.cratesiounofficial.yml                    22-Feb-2021 12:18                1035
com.bmpak.anagramsolver.yml                        22-Feb-2021 12:18                1288
com.boardgamegeek.yml                              22-Feb-2021 12:18                3026
com.bobbyrne01.howfardoyouswim.yml                 22-Feb-2021 12:18                 535
com.boombuler.games.shift.yml                      22-Feb-2021 12:18                 514
com.boombuler.piraten.map.yml                      22-Feb-2021 12:18                1178
com.boombuler.widgets.contacts.yml                 22-Feb-2021 12:18                 681
com.borneq.heregpslocation.yml                     22-Feb-2021 12:18                 509
com.botbrew.basil.yml                              22-Feb-2021 12:18                2147
com.bottleworks.dailymoney.yml                     22-Feb-2021 12:18                1445
com.boztalay.puppyframeuid.yml                     22-Feb-2021 12:18                 606
com.brackeys.ui.yml                                22-Feb-2021 12:18                 855
com.brapeba.roaminginfo.yml                        22-Feb-2021 12:18                4171
com.brentpanther.bitcoincashwidget.yml             22-Feb-2021 12:18                1489
com.brentpanther.bitcoinwidget.yml                 22-Feb-2021 12:18                8607
com.brentpanther.ethereumwidget.yml                22-Feb-2021 12:18                1572
com.brentpanther.litecoinwidget.yml                22-Feb-2021 12:18                1572
com.bretternst.URLazy.yml                          22-Feb-2021 12:18                1370
com.brewcrewfoo.performance.yml                    22-Feb-2021 12:18                2273
com.bri1.soundbored.yml                            22-Feb-2021 12:18                 599
com.brianco.colorclock.yml                         22-Feb-2021 12:18                 614
com.briankhuu.nfcmessageboard.yml                  22-Feb-2021 12:18                3119
com.brillenheini.deepscratch.free.yml              22-Feb-2021 12:18                 477
com.brockoli.android.hsdroid.yml                   22-Feb-2021 12:18                1319
com.brocktice.JustSit.yml                          22-Feb-2021 12:18                 741
com.brosmike.airpushdetector.yml                   22-Feb-2021 12:18                 821
com.brouken.player.yml                             22-Feb-2021 12:18                6725
com.brucelet.spacetrader.yml                       22-Feb-2021 12:18                1391
com.btcontract.wallet.yml                          22-Feb-2021 12:18                4761
com.btmura.android.reddit.yml                      22-Feb-2021 12:18                1901
com.bvalosek.cpuspy.yml                            22-Feb-2021 12:18                 531
com.bwx.bequick.yml                                22-Feb-2021 12:18                1087
com.byagowi.persiancalendar.yml                    22-Feb-2021 12:18                6791
com.bytehamster.changelog.yml                      22-Feb-2021 12:18                2491
com.bytesforge.linkasanote.yml                     22-Feb-2021 12:18                1038
com.bytestemplar.tonedef.yml                       22-Feb-2021 12:18                1747
com.call.recorder.yml                              22-Feb-2021 12:18                1034
com.callrecorder.android.yml                       22-Feb-2021 12:18                1286
com.casimirlab.simpleDeadlines.yml                 22-Feb-2021 12:18                1598
com.catchingnow.tinyclipboardmanager.yml           22-Feb-2021 12:18                1340
com.cause.commune.yml                              22-Feb-2021 12:18                1752
com.cebesius.materialhash.yml                      22-Feb-2021 12:18                 639
com.cebesius.wifiautoforget.yml                    22-Feb-2021 12:18                1070
com.cepmuvakkit.times.yml                          22-Feb-2021 12:18                 579
com.cg.lrceditor.yml                               22-Feb-2021 12:18                 838
com.cgogolin.library.yml                           22-Feb-2021 12:18                1602
com.chanapps.four.activity.yml                     22-Feb-2021 12:18                7732
com.chancehorizon.just24hoursplus.yml              22-Feb-2021 12:18                1832
com.chessclock.android.yml                         22-Feb-2021 12:18                1197
com.chmod0.manpages.yml                            22-Feb-2021 12:18                 584
com.chrisheald.flexauth.yml                        22-Feb-2021 12:18                 684
com.ciarang.tallyphant.yml                         22-Feb-2021 12:18                1091
com.cityfreqs.littlesirecho.yml                    22-Feb-2021 12:18                1151
com.cityzen.cityzen.yml                            22-Feb-2021 12:18                1567
com.claha.showtimeremote.yml                       22-Feb-2021 12:18                1154
com.cleveroad.sample.yml                           22-Feb-2021 12:18                 614
com.clickgostudio.air1072.yml                      22-Feb-2021 12:18                 676
com.coboltforge.dontmind.multivnc.yml              22-Feb-2021 12:18                5583
com.code.android.vibevault.yml                     22-Feb-2021 12:18                1293
com.code61.deadpixel.yml                           22-Feb-2021 12:18                 918
com.codebutler.farebot.yml                         22-Feb-2021 12:18                1258
com.colinmcdonough.android.torch.yml               22-Feb-2021 12:18                 557
com.collabora.libreoffice.yml                      22-Feb-2021 12:18                8706
com.colnix.fta.yml                                 22-Feb-2021 12:18                 597
com.color.colornamer.yml                           22-Feb-2021 12:18                 756
com.commit451.gitlab.yml                           22-Feb-2021 12:18                6573
com.commonslab.commonslab.yml                      22-Feb-2021 12:18                1059
com.commonsware.android.arXiv.yml                  22-Feb-2021 12:18                1801
com.concentricsky.android.khan.yml                 22-Feb-2021 12:18                1678
com.concept1tech.instalate.yml                     22-Feb-2021 12:18                 539
com.controlloid.yml                                22-Feb-2021 12:18                4667
com.cookiegames.smartcookie.yml                    22-Feb-2021 12:18                6173
com.corner23.android.beautyclocklivewallpaper.yml  22-Feb-2021 12:18                1076
com.corona_info.yml                                22-Feb-2021 12:18                 786
com.corphish.nightlight.generic.yml                22-Feb-2021 12:18                2517
com.corvettecole.gotosleep.yml                     22-Feb-2021 12:18                1093
com.coste.syncorg.yml                              22-Feb-2021 12:18                1767
com.cr5315.cfdc.yml                                22-Feb-2021 12:18                2023
com.cradle.iitc_mobile.yml                         22-Feb-2021 12:18               12752
com.craigd.lmsmaterial.app.yml                     22-Feb-2021 12:18                1205
com.crazyhitty.chdev.ks.munch.yml                  22-Feb-2021 12:18                1551
com.crazylegend.vigilante.yml                      22-Feb-2021 12:18                1108
com.csipsimple.yml                                 22-Feb-2021 12:18                3435
com.csmarosi.wifiautoff.yml                        22-Feb-2021 12:18                1240
com.ctemplar.app.fdroid.yml                        22-Feb-2021 12:18                2275
com.ctrlplusz.dashclock.yr.yml                     22-Feb-2021 12:18                1302
com.cyanogenmod.filemanager.ics.yml                22-Feb-2021 12:18                1259
com.cyanogenmod.lockclock.yml                      22-Feb-2021 12:18                 668
com.cybrosys.palmcalc.yml                          22-Feb-2021 12:18                 527
com.dacer.simplepomodoro.yml                       22-Feb-2021 12:18                 940
com.daemon.ssh.yml                                 22-Feb-2021 12:18                 501
com.dalthed.tucan.yml                              22-Feb-2021 12:18                3766
com.damiengo.websiterss.yml                        22-Feb-2021 12:18                1015
com.danefinlay.ttsutil.yml                         22-Feb-2021 12:18                 927
com.danhasting.radar.yml                           22-Feb-2021 12:18                 758
com.daniel.mobilepauker2.yml                       22-Feb-2021 12:18                1324
com.danielkim.soundrecorder.yml                    22-Feb-2021 12:18                1387
com.danielme.muspyforandroid.yml                   22-Feb-2021 12:18                1184
com.danvelazco.fbwrapper.yml                       22-Feb-2021 12:18                2985
com.dar.nclientv2.yml                              22-Feb-2021 12:18                5699
com.darknessmap.yml                                22-Feb-2021 12:18                 457
com.darshancomputing.BatteryIndicator.yml          22-Feb-2021 12:18                1719
com.darshancomputing.BatteryIndicatorPro.yml       22-Feb-2021 12:18                2653
com.daviancorp.android.mh4udatabase.yml            22-Feb-2021 12:18                2542
com.daviancorp.android.monsterhunter3udatabase.yml 22-Feb-2021 12:18                1067
com.davidshewitt.admincontrol.yml                  22-Feb-2021 12:18                 864
com.dconstructing.cooper.yml                       22-Feb-2021 12:18                1637
com.debian.debiandroid.yml                         22-Feb-2021 12:18                1075
com.derek_s.hubble_gallery.yml                     22-Feb-2021 12:18                1480
com.dev.cromer.jason.cshelper.yml                  22-Feb-2021 12:18                1029
com.dev.xavier.tempusromanum.yml                   22-Feb-2021 12:18                1319
com.deva.knot.yml                                  22-Feb-2021 12:18                 496
com.developerfromjokela.motioneyeclient.yml        22-Feb-2021 12:18                 686
com.developfreedom.wordpowermadeeasy.yml           22-Feb-2021 12:18                1125
com.dfa.hubzilla_android.yml                       22-Feb-2021 12:18                1455
com.dftec.planetcon.yml                            22-Feb-2021 12:18                1724
com.dfzlv.gjjlt.caramelos.yml                      22-Feb-2021 12:18                 849
com.dgmltn.morphclock.app.yml                      22-Feb-2021 12:18                 926
com.diblui.fullcolemak.yml                         22-Feb-2021 12:18                 450
com.diegocarloslima.byakugallery.yml               22-Feb-2021 12:18                 849
com.digitalfishfun.openshift.yml                   22-Feb-2021 12:18                 713
com.digitallizard.nicecompass.yml                  22-Feb-2021 12:18                 602
com.dimension.tessercube.yml                       22-Feb-2021 12:18                1186
com.dimtion.shaarlier.yml                          22-Feb-2021 12:18                2509
com.dirkgassen.wator.yml                           22-Feb-2021 12:18                1729
com.dje.openwifinetworkremover.yml                 22-Feb-2021 12:18                1384
com.dkanada.chip.yml                               22-Feb-2021 12:18                 854
com.dkanada.gramophone.yml                         22-Feb-2021 12:18                1422
com.dkanada.icecons.yml                            22-Feb-2021 12:18                4047
com.dkanada.openapk.yml                            22-Feb-2021 12:18                2211
com.dngames.mobilewebcam.yml                       22-Feb-2021 12:18                2916
com.dnielfe.manager.yml                            22-Feb-2021 12:18                5751
com.docd.purefm.yml                                22-Feb-2021 12:18                1287
com.donnnno.arcticons.yml                          22-Feb-2021 12:18                1052
com.doomy.overflow.yml                             22-Feb-2021 12:18                1137
com.doomy.torch.yml                                22-Feb-2021 12:18                 665
com.doplgangr.secrecy.yml                          22-Feb-2021 12:18                 852
com.dosse.airpods.yml                              22-Feb-2021 12:18                2221
com.dosse.bwentrain.androidPlayer.yml              22-Feb-2021 12:18                1043
com.dosse.chromiumautoupdater.yml                  22-Feb-2021 12:18                2438
com.dosse.speedtest.yml                            22-Feb-2021 12:18                1598
com.dougkeen.bart.yml                              22-Feb-2021 12:18                2879
com.dozingcatsoftware.asciicam.yml                 22-Feb-2021 12:18                2635
com.dozingcatsoftware.bouncy.yml                   22-Feb-2021 12:18                9991
com.dozingcatsoftware.cameratimer.yml              22-Feb-2021 12:18                 992
com.dozingcatsoftware.dodge.yml                    22-Feb-2021 12:18                 363
com.dozingcatsoftware.mouse_pounce.yml             22-Feb-2021 12:18                 833
com.dozingcatsoftware.vectorcamera.yml             22-Feb-2021 12:18                5999
com.dozuki.ifixit.yml                              22-Feb-2021 12:18                5833
com.dp.logcatapp.yml                               22-Feb-2021 12:18                2943
com.dragons.aurora.yml                             22-Feb-2021 12:18                1179
com.drhoffmannstoolsdataloggerreader.yml           22-Feb-2021 12:18                1852
com.drip.yml                                       22-Feb-2021 12:18                3157
com.dririan.RingyDingyDingy.yml                    22-Feb-2021 12:18                1259
com.drismo.yml                                     22-Feb-2021 12:18                1166
com.drodin.tuxrider.yml                            22-Feb-2021 12:18                1177
com.drodin.zxdroid.yml                             22-Feb-2021 12:18                2014
com.droidwave.offlinecalendar.yml                  22-Feb-2021 12:18                 752
com.ds.avare.yml                                   22-Feb-2021 12:18                5898
com.duckduckgo.mobile.android.yml                  22-Feb-2021 12:18               21048
com.dwak.lastcall.yml                              22-Feb-2021 12:18                 911
com.dwalkes.android.toggleheadset2.yml             22-Feb-2021 12:18                 693
com.dynamicg.homebuttonlauncher.yml                22-Feb-2021 12:18                 721
com.dynamite.heaterrc.yml                          22-Feb-2021 12:18                1017
com.earthblood.tictactoe.yml                       22-Feb-2021 12:18                 530
com.easwareapps.baria.yml                          22-Feb-2021 12:18                 826
com.easwareapps.f2lflap2lock_adfree.yml            22-Feb-2021 12:18                1321
com.easwareapps.g2l.yml                            22-Feb-2021 12:18                1249
com.easwareapps.marbleone_ad_free.yml              22-Feb-2021 12:18                1502
com.easwareapps.quoter.yml                         22-Feb-2021 12:18                 725
com.easwareapps.transparentwidget.yml              22-Feb-2021 12:18                 970
com.easyfitness.yml                                22-Feb-2021 12:18                2897
com.easytarget.micopi.yml                          22-Feb-2021 12:18                3173
com.ebaschiera.triplecamel.yml                     22-Feb-2021 12:18                1932
com.ecuamobi.deckwallet.yml                        22-Feb-2021 12:18                 730
com.eddyspace.networkmonitor.yml                   22-Feb-2021 12:18                 830
com.edwardoyarzun.diccionario.yml                  22-Feb-2021 12:18                 697
com.ei.bmicalc.yml                                 22-Feb-2021 12:18                 706
com.eibriel.reddot.yml                             22-Feb-2021 12:18                1141
com.eightsines.firestrike.opensource.yml           22-Feb-2021 12:18                 704
com.einmalfel.podlisten.yml                        22-Feb-2021 12:18                3112
com.elementarytoday.theia.yml                      22-Feb-2021 12:18                1882
com.eletac.tronwallet.yml                          22-Feb-2021 12:18                1217
com.eleybourn.bookcatalogue.yml                    22-Feb-2021 12:18                5594
com.elsdoerfer.android.autostarts.yml              22-Feb-2021 12:18                3193
com.elsewhat.android.currentwallpaper.yml          22-Feb-2021 12:18                 663
com.emacberry.uuid0xfd6fscan.yml                   22-Feb-2021 12:18                1488
com.emanuelef.remote_capture.yml                   22-Feb-2021 12:18                1535
com.emmaguy.cleanstatusbar.yml                     22-Feb-2021 12:18                 887
com.emmanuelmess.simpleaccounting.yml              22-Feb-2021 12:18                1481
com.emmanuelmess.simplecleanup.yml                 22-Feb-2021 12:18                1488
com.emmanuelmess.tictactoe.yml                     22-Feb-2021 12:18                 475
com.endeepak.dotsnsquares.yml                      22-Feb-2021 12:18                 662
com.eneko.hexcolortimewallpaper.yml                22-Feb-2021 12:18                1116
com.enjoyingfoss.feeel.yml                         22-Feb-2021 12:18                2512
com.enjoyingfoss.om.yml                            22-Feb-2021 12:18                 619
com.enrico.earthquake.batterysimplysolid.yml       22-Feb-2021 12:18                2314
com.enrico.earthquake.yml                          22-Feb-2021 12:18                1660
com.enrico.filemanager.yml                         22-Feb-2021 12:18                 987
com.enrico.sample.yml                              22-Feb-2021 12:18                1053
com.ensoft.imgurviewer.yml                         22-Feb-2021 12:18                 895
com.eolwral.osmonitor.yml                          22-Feb-2021 12:18               12400
com.episode6.android.appalarm.pro.yml              22-Feb-2021 12:18                 944
com.etesync.notes.yml                              22-Feb-2021 12:18               14346
com.etesync.syncadapter.yml                        22-Feb-2021 12:18               14581
com.euedge.openaviationmap.android.yml             22-Feb-2021 12:18                 775
com.evancharlton.mileage.yml                       22-Feb-2021 12:18                1290
com.evenement.encapsulation.yml                    22-Feb-2021 12:18                1319
com.eventyay.attendee.yml                          22-Feb-2021 12:18                2081
com.eventyay.organizer.yml                         22-Feb-2021 12:18                1719
com.everysoft.autoanswer.yml                       22-Feb-2021 12:18                 819
com.evilinsult.yml                                 22-Feb-2021 12:18                 728
com.example.CosyDVR.yml                            22-Feb-2021 12:18                2604
com.example.android.maxpapers.yml                  22-Feb-2021 12:18                 728
com.example.android.monthcalendarwidget.yml        22-Feb-2021 12:18                 632
com.example.anycut.yml                             22-Feb-2021 12:18                 917
com.example.barcodescanner.yml                     22-Feb-2021 12:18                1162
com.example.booklistingapk.yml                     22-Feb-2021 12:18                 655
com.example.dozenalclock.yml                       22-Feb-2021 12:18                 576
com.example.dozencalc.yml                          22-Feb-2021 12:18                 527
com.example.forgottenumbrella.cardboardmuseum.yml  22-Feb-2021 12:18                1868
com.example.harisont.librery.yml                   22-Feb-2021 12:18                 828
com.example.hochi.nextcompanion.yml                22-Feb-2021 12:18                1272
com.example.ismael.downloadfilesweb.yml            22-Feb-2021 12:18                 726
com.example.muzei.muzeiapod.yml                    22-Feb-2021 12:18                1089
com.example.openpass.yml                           22-Feb-2021 12:18                 616
com.example.root.analyticaltranslator.yml          22-Feb-2021 12:18                1589
com.example.siete_media.yml                        22-Feb-2021 12:18                1886
com.example.sshtry.yml                             22-Feb-2021 12:18                 764
com.example.tobiastrumm.freifunkautoconnect.yml    22-Feb-2021 12:18                1438
com.example.trigger.yml                            22-Feb-2021 12:18                3084
com.f.coin.yml                                     22-Feb-2021 12:18                 732
com.f0x.eddymalou.yml                              22-Feb-2021 12:18                 593
com.f2prateek.dfg.yml                              22-Feb-2021 12:18                1249
com.fabienli.dokuwiki.yml                          22-Feb-2021 12:18                 861
com.fairphone.clock.yml                            22-Feb-2021 12:18                2018
com.fairphone.mycontacts.yml                       22-Feb-2021 12:18                1686
com.fake.android.torchlight.yml                    22-Feb-2021 12:18                 911
com.falconware.prestissimo.yml                     22-Feb-2021 12:18                1082
com.faltenreich.diaguard.yml                       22-Feb-2021 12:18                1264
com.farmerbb.notepad.yml                           22-Feb-2021 12:18                2400
com.farmerbb.secondscreen.free.yml                 22-Feb-2021 12:18                2086
com.farmerbb.taskbar.yml                           22-Feb-2021 12:18               10982
com.fastaccess.github.libre.yml                    22-Feb-2021 12:18                3472
com.fastaccess.github.yml                          22-Feb-2021 12:18                3430
com.fastebro.androidrgbtool.yml                    22-Feb-2021 12:18                2074
com.fediphoto.yml                                  22-Feb-2021 12:18                1900
com.ferrarid.converterpro.yml                      22-Feb-2021 12:18                1825
com.fgrim.msnake.yml                               22-Feb-2021 12:18                1156
com.finnmglas.launcher.yml                         22-Feb-2021 12:18                 882
com.fisheradelakin.interactivestory.yml            22-Feb-2021 12:18                 546
com.fisheradelakin.vortex.yml                      22-Feb-2021 12:18                1404
com.fivasim.antikythera.yml                        22-Feb-2021 12:18                1030
com.flasskamp.subz.yml                             22-Feb-2021 12:18                 471
com.flipcamera.yml                                 22-Feb-2021 12:18                1105
com.flx_apps.digitaldetox.yml                      22-Feb-2021 12:18                 959
com.flxrs.dankchat.yml                             22-Feb-2021 12:18                5967
com.foobnix.pro.pdf.reader.yml                     22-Feb-2021 12:18               17521
com.formfun.yml                                    22-Feb-2021 12:18                1812
com.forrestguice.suntimescalendars.yml             22-Feb-2021 12:18                1843
com.forrestguice.suntimeswidget.yml                22-Feb-2021 12:18                8450
com.forum.fiend.osp.yml                            22-Feb-2021 12:18                1023
com.foxykeep.lifecounter.yml                       22-Feb-2021 12:18                 817
com.fproject.cryptolitycs.yml                      22-Feb-2021 12:18                1452
com.fr3ts0n.androbd.plugin.gpsprovider.yml         22-Feb-2021 12:18                 861
com.fr3ts0n.androbd.plugin.mqtt.yml                22-Feb-2021 12:18                1097
com.fr3ts0n.androbd.plugin.sensorprovider.yml      22-Feb-2021 12:18                 870
com.fr3ts0n.ecu.gui.androbd.yml                    22-Feb-2021 12:18               39252
com.fr3ts0n.stagefever.yml                         22-Feb-2021 12:18                3227
com.frankcalise.h2droid.yml                        22-Feb-2021 12:18                 473
com.freerdp.afreerdp.yml                           22-Feb-2021 12:18                5323
com.freezingwind.animereleasenotifier.yml          22-Feb-2021 12:18                1295
com.freshollie.monkeyboard.keystoneradio.yml       22-Feb-2021 12:18                1501
com.frostwire.android.yml                          22-Feb-2021 12:18                2147
com.frozendevs.cache.cleaner.yml                   22-Feb-2021 12:18                3986
com.frozendevs.periodictable.yml                   22-Feb-2021 12:18                1518
com.frrahat.quransimple.yml                        22-Feb-2021 12:18                3306
com.fsck.k9.material.yml                           22-Feb-2021 12:18                1362
com.fsck.k9.yml                                    22-Feb-2021 12:18               22176
com.fullscreen.yml                                 22-Feb-2021 12:18                 801
com.fusionx.lightirc.yml                           22-Feb-2021 12:18                 676
com.futonredemption.mylocation.yml                 22-Feb-2021 12:18                 628
com.futurice.android.reservator.yml                22-Feb-2021 12:18                1865
com.gabm.fancyplaces.yml                           22-Feb-2021 12:18                1820
com.gabm.screenrotationcontrol.yml                 22-Feb-2021 12:18                2081
com.gabriel.covid19stats.yml                       22-Feb-2021 12:18                4789
com.gacode.relaunchx.yml                           22-Feb-2021 12:18                1815
com.games.boardgames.aeonsend.yml                  22-Feb-2021 12:18                 784
com.garyodernichts.downgrader.yml                  22-Feb-2021 12:18                 521
com.gatheringhallstudios.mhworlddatabase.yml       22-Feb-2021 12:18                 740
com.gbeatty.arxiv.yml                              22-Feb-2021 12:18                 694
com.gcstar.scanner.yml                             22-Feb-2021 12:18                 773
com.gcstar.viewer.yml                              22-Feb-2021 12:18                 885
com.geecko.QuickLyric.yml                          22-Feb-2021 12:18                4428
com.gelakinetic.mtgfam.yml                         22-Feb-2021 12:18               11219
com.genonbeta.TrebleShot.yml                       22-Feb-2021 12:18                5785
com.germainz.activityforcenewtask.yml              22-Feb-2021 12:18                1020
com.germainz.identiconizer.yml                     22-Feb-2021 12:18                 735
com.gh4a.yml                                       22-Feb-2021 12:18                6956
com.ghisguth.sun.yml                               22-Feb-2021 12:18                 814
com.ghostsq.commander.https.yml                    22-Feb-2021 12:18                1392
com.ghostsq.commander.samba.yml                    22-Feb-2021 12:18                5248
com.ghostsq.commander.sftp.yml                     22-Feb-2021 12:18                4282
com.ghostsq.commander.yml                          22-Feb-2021 12:18               13090
com.ghstudios.android.mhgendatabase.yml            22-Feb-2021 12:18                2291
com.gianlu.aria2android.yml                        22-Feb-2021 12:18                7997
com.gianlu.aria2app.yml                            22-Feb-2021 12:18               17309
com.gianlu.dnshero.yml                             22-Feb-2021 12:18                7140
com.gianlu.pretendyourexyzzy.yml                   22-Feb-2021 12:18                7109
com.gimranov.zandy.app.yml                         22-Feb-2021 12:18                1590
com.ginkel.hashit.yml                              22-Feb-2021 12:18                 934
com.gitea.theoden8.sudaku.yml                      22-Feb-2021 12:18                2040
com.github.aba2l.taswast.yml                       22-Feb-2021 12:18                 646
com.github.alijc.cricketsalarm.yml                 22-Feb-2021 12:18                 745
com.github.andlyticsproject.yml                    22-Feb-2021 12:18                1930
com.github.andremiras.etheroll.yml                 22-Feb-2021 12:18                5628
com.github.andremiras.qrscan.yml                   22-Feb-2021 12:18                2062
com.github.andremiras.zbarcamdemo.yml              22-Feb-2021 12:18                1725
com.github.ashutoshgngwr.noice.yml                 22-Feb-2021 12:18                4456
com.github.ashutoshgngwr.tenbitclockwidget.yml     22-Feb-2021 12:18                1185
com.github.axet.audiorecorder.yml                  22-Feb-2021 12:18               21399
com.github.axet.binauralbeats.yml                  22-Feb-2021 12:18                1764
com.github.axet.bookreader.yml                     22-Feb-2021 12:18               21568
com.github.axet.callrecorder.yml                   22-Feb-2021 12:18               15094
com.github.axet.darknessimmunity.yml               22-Feb-2021 12:18                1641
com.github.axet.filemanager.yml                    22-Feb-2021 12:18                5194
com.github.axet.hourlyreminder.yml                 22-Feb-2021 12:18               17435
com.github.axet.maps.yml                           22-Feb-2021 12:18               14003
com.github.axet.mover.yml                          22-Feb-2021 12:18                4903
com.github.axet.smsgate.yml                        22-Feb-2021 12:18                8747
com.github.axet.tonegenerator.yml                  22-Feb-2021 12:18                1383
com.github.axet.torrentclient.yml                  22-Feb-2021 12:18               22125
com.github.catfriend1.syncthingandroid.yml         22-Feb-2021 12:18               50439
com.github.cetoolbox.yml                           22-Feb-2021 12:18                 830
com.github.characterdog.bmicalculator.yml          22-Feb-2021 12:18                 849
com.github.characterdog.share_my_number.yml        22-Feb-2021 12:18                 783
com.github.cvzi.screenshottile.yml                 22-Feb-2021 12:18                4853
com.github.cythara.yml                             22-Feb-2021 12:18                4221
com.github.darthjoey91.hangman.yml                 22-Feb-2021 12:18                1258
com.github.dawidd6.andttt.yml                      22-Feb-2021 12:18                 980
com.github.dfa.diaspora_android.yml                22-Feb-2021 12:18                5371
com.github.doomsdayrs.apps.shosetsu.yml            22-Feb-2021 12:18                 677
com.github.egonw.isotopes.yml                      22-Feb-2021 12:18                 677
com.github.fi3te.notificationcron.yml              22-Feb-2021 12:18                1320
com.github.funkyg.funkytunes.yml                   22-Feb-2021 12:18                1130
com.github.gianlucanitti.expreval.yml              22-Feb-2021 12:18                1799
com.github.gotify.yml                              22-Feb-2021 12:18                2450
com.github.grimpy.botifier.yml                     22-Feb-2021 12:18                1961
com.github.gschwind.fiddle_assistant.yml           22-Feb-2021 12:18                 799
com.github.igrmk.smsq.yml                          22-Feb-2021 12:18                1025
com.github.jtjj222.sudburytransit.yml              22-Feb-2021 12:18                 542
com.github.k1rakishou.chan.fdroid.yml              22-Feb-2021 12:18                 757
com.github.kiliakin.yalpstore.yml                  22-Feb-2021 12:18                2736
com.github.ktsr42.rsyncserver.yml                  22-Feb-2021 12:18                 881
com.github.marmalade.aRevelation.yml               22-Feb-2021 12:18                 711
com.github.mobile.yml                              22-Feb-2021 12:18                2367
com.github.mofosyne.instantreadme.yml              22-Feb-2021 12:18                 625
com.github.mofosyne.tagdrop.yml                    22-Feb-2021 12:18                1410
com.github.moko256.twitlatte.yml                   22-Feb-2021 12:18                4049
com.github.mueller_ma.viewandroidversion.yml       22-Feb-2021 12:18                 786
com.github.muellerma.coffee.yml                    22-Feb-2021 12:18                 995
com.github.muellerma.tabletoptools.yml             22-Feb-2021 12:18                 525
com.github.niccokunzmann.hanumanchalisa.yml        22-Feb-2021 12:18                 593
com.github.nicolassmith.urlevaluator.yml           22-Feb-2021 12:18                1346
com.github.niqdev.ipcam.yml                        22-Feb-2021 12:18                1070
com.github.notizklotz.derbunddownloader.yml        22-Feb-2021 12:18                1529
com.github.nutomic.controldlna.yml                 22-Feb-2021 12:18                2063
com.github.olga_yakovleva.rhvoice.android.yml      22-Feb-2021 12:18                 552
com.github.onetimepass.yml                         22-Feb-2021 12:18                1382
com.github.ooz.heymeditation.yml                   22-Feb-2021 12:18                1199
com.github.palmcalc2019.palmcalc.yml               22-Feb-2021 12:18                 903
com.github.pires.obd.reader.yml                    22-Feb-2021 12:18                 894
com.github.pockethub.android.yml                   22-Feb-2021 12:18                1487
com.github.postapczuk.lalauncher.yml               22-Feb-2021 12:18                2632
com.github.postapczuk.leplauncher.yml              22-Feb-2021 12:18                 688
com.github.premnirmal.tickerwidget.yml             22-Feb-2021 12:18               35299
com.github.quarck.calnotify.yml                    22-Feb-2021 12:18                9985
com.github.redpanal.android.yml                    22-Feb-2021 12:18                 714
com.github.rsteube.t4.yml                          22-Feb-2021 12:18                 370
com.github.ruleant.getback_gps.yml                 22-Feb-2021 12:18                3155
com.github.samotari.cryptoterminal.yml             22-Feb-2021 12:18                2756
com.github.shadowsocks.plugin.v2ray.yml            22-Feb-2021 12:18                1675
com.github.siggel.coordinatejoker.yml              22-Feb-2021 12:18                 535
com.github.sryze.wirebug.yml                       22-Feb-2021 12:18                2112
com.github.timnew.smartremotecontrol.yml           22-Feb-2021 12:18                 758
com.github.vauvenal5.yaga.yml                      22-Feb-2021 12:18                6886
com.github.wakhub.tinyclock.yml                    22-Feb-2021 12:18                 620
com.github.wdkapps.fillup.yml                      22-Feb-2021 12:18                2303
com.github.webierta.call_counter.yml               22-Feb-2021 12:18                 836
com.github.xloem.qrstream.yml                      22-Feb-2021 12:18                2025
com.github.yeriomin.dumbphoneassistant.yml         22-Feb-2021 12:18                1867
com.github.yeriomin.smsscheduler.yml               22-Feb-2021 12:18                1183
com.github.yeriomin.workoutlog.yml                 22-Feb-2021 12:18                 808
com.github.yeriomin.yalpstore.yml                  22-Feb-2021 12:18                7344
com.gitlab.ardash.appleflinger.android.yml         22-Feb-2021 12:18                4246
com.gitlab.dibdib.dib2calc.yml                     22-Feb-2021 12:18                 843
com.gitlab.giwiniswut.rwremount.yml                22-Feb-2021 12:18                 608
com.gitlab.kreikenbaum.suntime.fdroid.yml          22-Feb-2021 12:18                1685
com.gitlab.mahc9kez.shadowsocks.foss.yml           22-Feb-2021 12:18                4085
com.gitlab.terrakok.gitfox.yml                     22-Feb-2021 12:18                 552
com.gk.simpleworkoutjournal.yml                    22-Feb-2021 12:18                1158
com.glTron.yml                                     22-Feb-2021 12:18                 624
com.gladis.tictactoe.yml                           22-Feb-2021 12:18                 511
com.glanznig.beepme.yml                            22-Feb-2021 12:18                1026
com.gluegadget.hndroid.yml                         22-Feb-2021 12:18                 632
com.gmail.afonsotrepa.pocketgopher.yml             22-Feb-2021 12:18                1202
com.gmail.altakey.effy.yml                         22-Feb-2021 12:18                 536
com.gmail.anubhavdas54.whatsdeleted.yml            22-Feb-2021 12:18                 901
com.gmail.charleszq.yml                            22-Feb-2021 12:18                 573
com.gmail.jerickson314.sdscanner.yml               22-Feb-2021 12:18                1657
com.gmail.jiwopene.temperature.yml                 22-Feb-2021 12:18                1475
com.gmail.mugcuposup.android.yml                   22-Feb-2021 12:18                 634
com.gmail.walles.johan.batterylogger.yml           22-Feb-2021 12:18                1012
com.gokhanmoral.stweaks.app.yml                    22-Feb-2021 12:18                1288
com.goltzkiste.guessaday.yml                       22-Feb-2021 12:18                1257
com.googamaphone.typeandspeak.yml                  22-Feb-2021 12:18                 766
com.google.android.accessibility.talkback.yml      22-Feb-2021 12:18                1297
com.google.android.apps.authenticator2.yml         22-Feb-2021 12:18                2100
com.google.android.apps.iosched.yml                22-Feb-2021 12:18                1311
com.google.android.diskusage.yml                   22-Feb-2021 12:18                3699
com.google.android.gms.yml                         22-Feb-2021 12:18                5187
com.google.android.location.yml                    22-Feb-2021 12:18                3953
com.google.android.maps.mytracks.yml               22-Feb-2021 12:18                 616
com.google.android.marvin.talkback.yml             22-Feb-2021 12:18                2581
com.google.android.sambadocumentsprovider.yml      22-Feb-2021 12:18                1715
com.google.android.stardroid.yml                   22-Feb-2021 12:18                3999
com.google.code.apps2org.yml                       22-Feb-2021 12:18                1231
com.google.code.appsorganizer.yml                  22-Feb-2021 12:18                 905
com.google.code.geobeagle.yml                      22-Feb-2021 12:18                1162
com.google.marvin.shell.yml                        22-Feb-2021 12:18                1409
com.google.zxing.client.android.yml                22-Feb-2021 12:18                5570
com.googlecode.android.wifi.tether.yml             22-Feb-2021 12:18                1237
com.googlecode.android_scripting.yml               22-Feb-2021 12:18                1769
com.googlecode.awsms.yml                           22-Feb-2021 12:18                1011
com.googlecode.chartdroid.yml                      22-Feb-2021 12:18                 726
com.googlecode.droidwall.yml                       22-Feb-2021 12:18                1765
com.googlecode.eyesfree.espeak.yml                 22-Feb-2021 12:18                1119
com.googlecode.gogodroid.yml                       22-Feb-2021 12:18                1442
com.googlecode.gtalksms.yml                        22-Feb-2021 12:18                2265
com.googlecode.networklog.yml                      22-Feb-2021 12:18                7468
com.googlecode.openwnn.legacy.yml                  22-Feb-2021 12:18                 712
com.googlecode.tcime.yml                           22-Feb-2021 12:18                 469
com.governikus.ausweisapp2.yml                     22-Feb-2021 12:18                4522
com.gpl.rpg.AndorsTrail.yml                        22-Feb-2021 12:18                4185
com.gpstether.yml                                  22-Feb-2021 12:18                 559
com.gracecode.android.presentation.yml             22-Feb-2021 12:18                1064
com.grapefruitopia.dashclock.k9.yml                22-Feb-2021 12:18                1005
com.grarak.kerneladiutor.yml                       22-Feb-2021 12:18               15362
com.greenaddress.abcore.yml                        22-Feb-2021 12:18                5534
com.greenaddress.greenbits_android_wallet.testn..> 22-Feb-2021 12:18               11222
com.greenaddress.greenbits_android_wallet.yml      22-Feb-2021 12:18               59007
com.gregorywlodarek.torontotransit.torontotrans..> 22-Feb-2021 12:18                 899
com.grmasa.soundtoggle.yml                         22-Feb-2021 12:18                 466
com.grocerymanager.yml                             22-Feb-2021 12:18                 786
com.gs.mobileprint.yml                             22-Feb-2021 12:18                 548
com.gsnathan.pdfviewer.yml                         22-Feb-2021 12:18                1461
com.gtp.showapicturetoyourfriend.yml               22-Feb-2021 12:18                1747
com.gueei.applocker.yml                            22-Feb-2021 12:18                 479
com.guillaumepayet.remotenumpad.yml                22-Feb-2021 12:18                 625
com.gulshansingh.hackerlivewallpaper.yml           22-Feb-2021 12:18                1627
com.gunshippenguin.openflood.yml                   22-Feb-2021 12:18                1726
com.guvery.notifyme.yml                            22-Feb-2021 12:18                1063
com.haha01haha01.harail.yml                        22-Feb-2021 12:18                1941
com.halftough.webcomreader.yml                     22-Feb-2021 12:18                 972
com.harasoft.relaunch.yml                          22-Feb-2021 12:18                 667
com.hardcodecoder.pulsemusic.yml                   22-Feb-2021 12:18                 680
com.haringeymobile.ukweather.yml                   22-Feb-2021 12:18                2627
com.harleensahni.android.mbr.yml                   22-Feb-2021 12:18                1054
com.hasi.hasid00r.yml                              22-Feb-2021 12:18                 542
com.hayaisoftware.launcher.yml                     22-Feb-2021 12:18                2330
com.headuck.app.gooutwithduck.yml                  22-Feb-2021 12:18                 688
com.health.openscale.yml                           22-Feb-2021 12:18                9163
com.health.openworkout.yml                         22-Feb-2021 12:18                 917
com.hearham.repeaterstart.yml                      22-Feb-2021 12:18                 595
com.heb12.heb12.yml                                22-Feb-2021 12:18                 686
com.hectorone.multismssender.yml                   22-Feb-2021 12:18                1082
com.hermit.btreprap.yml                            22-Feb-2021 12:18                 715
com.hexad.bluezime.hidenabler.yml                  22-Feb-2021 12:18                 679
com.hexad.bluezime.yml                             22-Feb-2021 12:18                1664
com.hlidskialf.android.pomodoro.yml                22-Feb-2021 12:18                 792
com.hobbyone.HashDroid.yml                         22-Feb-2021 12:18                1803
com.holokenmod.yml                                 22-Feb-2021 12:18                1642
com.howeyc.spiped.yml                              22-Feb-2021 12:18                1433
com.htruong.inputmethod.latin.yml                  22-Feb-2021 12:18                1691
com.hughes.android.dictionary.yml                  22-Feb-2021 12:18                3328
com.hykwok.CurrencyConverter.yml                   22-Feb-2021 12:18                 713
com.hyperionics.fbreader.plugin.tts_plus.yml       22-Feb-2021 12:18                2982
com.iamtrk.androidexplorer.yml                     22-Feb-2021 12:18                 960
com.iatfei.streakalarm.yml                         22-Feb-2021 12:18                2064
com.iazasoft.footguy.yml                           22-Feb-2021 12:18                 814
com.iboalali.sysnotifsnooze.yml                    22-Feb-2021 12:18                 985
com.ibrahimyousre.resumebuilder.yml                22-Feb-2021 12:18                 874
com.icechen1.notable.pro.yml                       22-Feb-2021 12:18                2591
com.icecondor.nest.yml                             22-Feb-2021 12:18                2010
com.ichi2.anki.yml                                 22-Feb-2021 12:18               14893
com.ideasfrombrain.search_based_launcher_v2.yml    22-Feb-2021 12:18                1691
com.idunnololz.igo.yml                             22-Feb-2021 12:18                1130
com.igisw.openmoneybox.yml                         22-Feb-2021 12:18                3264
com.igormaznitsa.piratedice.yml                    22-Feb-2021 12:18                1180
com.ihunda.android.binauralbeat.yml                22-Feb-2021 12:18                1724
com.ilm.sandwich.yml                               22-Feb-2021 12:18                3264
com.indieweb.indigenous.yml                        22-Feb-2021 12:18                3914
com.infomaniak.sync.yml                            22-Feb-2021 12:18                1068
com.infonuascape.osrshelper.yml                    22-Feb-2021 12:18                2930
com.innodroid.mongobrowser.yml                     22-Feb-2021 12:18                1036
com.integralblue.callerid.yml                      22-Feb-2021 12:18                 844
com.internalpositioning.find3.find3app.yml         22-Feb-2021 12:18                2427
com.intervigil.micdroid.yml                        22-Feb-2021 12:18                1689
com.intrications.android.sharebrowser.yml          22-Feb-2021 12:18                 897
com.invano.ambientweather.yml                      22-Feb-2021 12:18                1208
com.irahul.worldclock.yml                          22-Feb-2021 12:18                 566
com.isaacparker.dozesettingseditor.yml             22-Feb-2021 12:18                1091
com.isanexusdev.androidcpg.yml                     22-Feb-2021 12:18                1011
com.isdp.trirose.yml                               22-Feb-2021 12:18                 763
com.iskrembilen.quasseldroid.yml                   22-Feb-2021 12:18                8263
com.itds.sms.ping.yml                              22-Feb-2021 12:18                1073
com.ivanvolosyuk.sharetobrowser.yml                22-Feb-2021 12:18                1225
com.iven.iconify.yml                               22-Feb-2021 12:18                1643
com.iven.lfflfeedreader.yml                        22-Feb-2021 12:18               10393
com.iven.musicplayergo.yml                         22-Feb-2021 12:18                8475
com.iven.xdafeedreader.yml                         22-Feb-2021 12:18                1612
com.jackpf.apkdownloader.yml                       22-Feb-2021 12:18                1810
com.jadn.cc.yml                                    22-Feb-2021 12:18                2488
com.jairaj.janglegmail.motioneye.yml               22-Feb-2021 12:18                 638
com.jakebasile.android.hearingsaver.yml            22-Feb-2021 12:18                1208
com.jakewharton.sdksearch.yml                      22-Feb-2021 12:18                 917
com.jakewharton.telecine.yml                       22-Feb-2021 12:18                1661
com.james.status.yml                               22-Feb-2021 12:18                1168
com.jarsilio.android.autoautorotate.yml            22-Feb-2021 12:18                2441
com.jarsilio.android.drowser.yml                   22-Feb-2021 12:18                2331
com.jarsilio.android.pocketup.yml                  22-Feb-2021 12:18                1826
com.jarsilio.android.scrambledeggsif.yml           22-Feb-2021 12:18                6789
com.jarsilio.android.waveup.tasker.yml             22-Feb-2021 12:18                 808
com.jarsilio.android.waveup.yml                    22-Feb-2021 12:18               12175
com.java.SmokeReducer.yml                          22-Feb-2021 12:18                 621
com.javierllorente.adc.yml                         22-Feb-2021 12:18                 607
com.javiersantos.mlmanager.yml                     22-Feb-2021 12:18                2435
com.javiersantos.mlmanagerpro.yml                  22-Feb-2021 12:18                1733
com.javiersantos.whatsappbetaupdater.yml           22-Feb-2021 12:18                1539
com.jaygoel.virginminuteschecker.yml               22-Feb-2021 12:18                 906
com.jbirdvegas.mgerrit.yml                         22-Feb-2021 12:18                1259
com.jecelyin.editor.yml                            22-Feb-2021 12:18                1442
com.jeffboody.GearsES2eclair.yml                   22-Feb-2021 12:18                1388
com.jeffliu.balancetheball.yml                     22-Feb-2021 12:18                 630
com.jefftharris.passwdsafe.yml                     22-Feb-2021 12:18                5538
com.jelly.theme.revenge.yml                        22-Feb-2021 12:18                 458
com.jellyshack.block6.yml                          22-Feb-2021 12:18                 530
com.jereksel.libresubstratum.yml                   22-Feb-2021 12:18                 908
com.jeyries.quake2.yml                             22-Feb-2021 12:18                 738
com.jforce.chapelhillnextbus.yml                   22-Feb-2021 12:18                1547
com.jim.sharetocomputer.yml                        22-Feb-2021 12:18                1243
com.jkcarino.ankieditor.yml                        22-Feb-2021 12:18                1185
com.jkuester.unlauncher.yml                        22-Feb-2021 12:18                 800
com.jlyr.yml                                       22-Feb-2021 12:18                1153
com.jmartin.temaki.yml                             22-Feb-2021 12:18                 613
com.jmartin.writeily.yml                           22-Feb-2021 12:18                1657
com.jmelzer.myttr.yml                              22-Feb-2021 12:18                1819
com.jmstudios.chibe.yml                            22-Feb-2021 12:18                1855
com.jmstudios.pointandhit.android.yml              22-Feb-2021 12:18                 864
com.jmstudios.redmoon.yml                          22-Feb-2021 12:18                4092
com.johan.vertretungsplan.yml                      22-Feb-2021 12:18                1411
com.jonbanjo.cupsprintservice.yml                  22-Feb-2021 12:18                 679
com.jonglen7.jugglinglab.yml                       22-Feb-2021 12:18                 901
com.jonjomckay.fritter.yml                         22-Feb-2021 12:18                1142
com.jorgecastillo.kanadrill.yml                    22-Feb-2021 12:18                2924
com.joshtwigg.cmus.droid.yml                       22-Feb-2021 12:18                1635
com.jotabout.screeninfo.yml                        22-Feb-2021 12:18                1135
com.jovial.jrpn.yml                                22-Feb-2021 12:18                 576
com.jparkie.aizoban.yml                            22-Feb-2021 12:18                1521
com.jparkie.givesmehope.yml                        22-Feb-2021 12:18                1484
com.jpwolfso.privdnsqt.yml                         22-Feb-2021 12:18                1418
com.jstappdev.dbclf.yml                            22-Feb-2021 12:18                1816
com.jstephan.yarc.yml                              22-Feb-2021 12:18                 615
com.jtechme.jumpgo.yml                             22-Feb-2021 12:18                2238
com.jtmcn.archwiki.viewer.yml                      22-Feb-2021 12:18                1058
com.juet.attendance.yml                            22-Feb-2021 12:18                1865
com.juliansparber.captiveportallogin.yml           22-Feb-2021 12:18                 814
com.junjunguo.pocketmaps.yml                       22-Feb-2021 12:18                2393
com.jvillalba.apod.classic.yml                     22-Feb-2021 12:18                 804
com.jvillalba.apod.md.yml                          22-Feb-2021 12:18                 812
com.jwetherell.heart_rate_monitor.yml              22-Feb-2021 12:18                 631
com.kabouzeid.gramophone.yml                       22-Feb-2021 12:18                2589
com.kaeruct.glxy.yml                               22-Feb-2021 12:18                 852
com.kai1973i.yml                                   22-Feb-2021 12:18                 677
com.kaliturin.blacklist.yml                        22-Feb-2021 12:18                1176
com.kanedias.archforums.yml                        22-Feb-2021 12:18                2077
com.kanedias.holywarsoo.yml                        22-Feb-2021 12:18                4768
com.kanedias.vanilla.audiotag.yml                  22-Feb-2021 12:18                6695
com.kanedias.vanilla.coverfetch.yml                22-Feb-2021 12:18                3158
com.kanedias.vanilla.lyrics.yml                    22-Feb-2021 12:18                3222
com.kanedias.vanilla.metadata.yml                  22-Feb-2021 12:18                2025
com.kaneoriley.cyanogenport.launcher3.yml          22-Feb-2021 12:18                1282
com.kazufukurou.nanji.yml                          22-Feb-2021 12:18                 977
com.kennyc.open.imgur.yml                          22-Feb-2021 12:18                1503
com.keylesspalace.tusky.yml                        22-Feb-2021 12:18                5904
com.kgurgul.cpuinfo.yml                            22-Feb-2021 12:18                2585
com.khuttun.notificationnotes.yml                  22-Feb-2021 12:18                1602
com.kibab.android.EncPassChanger.yml               22-Feb-2021 12:18                1224
com.kkinder.charmap.yml                            22-Feb-2021 12:18                 867
com.kkinder.sharelocation.yml                      22-Feb-2021 12:18                 879
com.kmac5dev.mindfulnotifier.yml                   22-Feb-2021 12:18                 998
com.kmagic.solitaire.yml                           22-Feb-2021 12:18                 847
com.kn.paper_foss_theme.yml                        22-Feb-2021 12:18                3740
com.knirirr.beecount.yml                           22-Feb-2021 12:18                5400
com.kodarkooperativet.notificationstopwatch.yml    22-Feb-2021 12:18                 856
com.kokkle.gamevirusattack.yml                     22-Feb-2021 12:18                 677
com.kolloware.hypezigapp.yml                       22-Feb-2021 12:18                1476
com.kolloware.wechange.yml                         22-Feb-2021 12:18                 712
com.kostmo.wallpaper.spiral.yml                    22-Feb-2021 12:18                 602
com.koushikdutta.superuser.yml                     22-Feb-2021 12:18                1646
com.kpz.pomodorotasks.activity.yml                 22-Feb-2021 12:18                 524
com.krawieck.lemmur.yml                            22-Feb-2021 12:18                 924
com.ktprograms.ohmsnow.yml                         22-Feb-2021 12:18                 758
com.ktprograms.watertracker.yml                    22-Feb-2021 12:18                 620
com.kunzisoft.keepass.libre.yml                    22-Feb-2021 12:18                6694
com.kunzisoft.keyboard.switcher.yml                22-Feb-2021 12:18                1785
com.kure.musicplayer.yml                           22-Feb-2021 12:18                1005
com.kvance.Nectroid.yml                            22-Feb-2021 12:18                1053
com.kyakujin.android.tagnotepad.yml                22-Feb-2021 12:18                 628
com.kylecorry.trail_sense.yml                      22-Feb-2021 12:18                2960
com.lako.moclock.yml                               22-Feb-2021 12:18                 508
com.lako.walletcount.yml                           22-Feb-2021 12:18                 465
com.launcher.silverfish.yml                        22-Feb-2021 12:18                2357
com.lavadip.miniVector.yml                         22-Feb-2021 12:18               19084
com.leafdigital.kanji.android.yml                  22-Feb-2021 12:18                1260
com.lecz.android.tiltmazes.yml                     22-Feb-2021 12:18                 656
com.leinardi.kitchentimer.yml                      22-Feb-2021 12:18                 405
com.leinardi.ubuntucountdownwidget.yml             22-Feb-2021 12:18                 700
com.leocardz.multitouch.test.yml                   22-Feb-2021 12:18                 863
com.leocardz.url.unshortener.yml                   22-Feb-2021 12:18                 892
com.lesspass.android.yml                           22-Feb-2021 12:18                8037
com.lgallardo.qbittorrentclient.yml                22-Feb-2021 12:18                4521
com.lgallardo.qbittorrentclientpro.yml             22-Feb-2021 12:18                2060
com.liato.bankdroid.yml                            22-Feb-2021 12:18               12589
com.libopenmw.openmw.yml                           22-Feb-2021 12:18                2627
com.lightbox.android.camera.yml                    22-Feb-2021 12:18                 842
com.lightning.walletapp.yml                        22-Feb-2021 12:18                1211
com.lightplanx.xddk.yml                            22-Feb-2021 12:18                1038
com.limbo.emu.main.yml                             22-Feb-2021 12:18                3222
com.limelight.yml                                  22-Feb-2021 12:18              108307
com.lindevhard.android.raspfinder.yml              22-Feb-2021 12:18                1271
com.linkomnia.android.Changjie.yml                 22-Feb-2021 12:18                 802
com.linuxcounter.lico_update_003.yml               22-Feb-2021 12:18                1138
com.lithium.leona.openstud.yml                     22-Feb-2021 12:18                8563
com.litmus.worldscope.yml                          22-Feb-2021 12:18                 852
com.littlebytesofpi.pylauncher.yml                 22-Feb-2021 12:18                1258
com.liveplayergames.finneypoker.yml                22-Feb-2021 12:18                1921
com.llamacorp.equate.yml                           22-Feb-2021 12:18                2154
com.lligainterm.yml                                22-Feb-2021 12:18                 752
com.log28.yml                                      22-Feb-2021 12:18                 877
com.lolo.io.onelist.yml                            22-Feb-2021 12:18                3386
com.lonepulse.travisjr.yml                         22-Feb-2021 12:18                1236
com.longevitysoft.android.appwidget.hstfeed.yml    22-Feb-2021 12:18                1065
com.lostrealm.lembretes.yml                        22-Feb-2021 12:18                1287
com.lucao.limpazap.yml                             22-Feb-2021 12:18                 891
com.lucasdnd.bitclock16.yml                        22-Feb-2021 12:18                 685
com.lucasdnd.decimaltimeclockwidget.yml            22-Feb-2021 12:18                 778
com.lucasdnd.unixtimeclockwidget.yml               22-Feb-2021 12:18                 570
com.luk.saucenao.yml                               22-Feb-2021 12:18                1470
com.luk.timetable2.yml                             22-Feb-2021 12:18                3193
com.lukekorth.screennotifications.yml              22-Feb-2021 12:18                2532
com.lun.chin.aicamera.yml                          22-Feb-2021 12:18                1096
com.luorrak.ouroboros.yml                          22-Feb-2021 12:18                3705
com.lyonbros.turtl.yml                             22-Feb-2021 12:18               12260
com.m3sv.plainupnp.yml                             22-Feb-2021 12:18                1163
com.machiav3lli.backup.yml                         22-Feb-2021 12:18                2673
com.machiav3lli.derdiedas.yml                      22-Feb-2021 12:18                 560
com.madgag.agit.yml                                22-Feb-2021 12:18                1840
com.madlonkay.orgro.yml                            22-Feb-2021 12:18                1700
com.majeur.applicationsinfo.yml                    22-Feb-2021 12:18                1611
com.makeinfo.sudokugenerator.yml                   22-Feb-2021 12:18                 616
com.malek.alldebrid.yml                            22-Feb-2021 12:18                 617
com.manichord.mgit.yml                             22-Feb-2021 12:18                2316
com.manimarank.spell4wiki.yml                      22-Feb-2021 12:18                 817
com.manimarank.websitemonitor.yml                  22-Feb-2021 12:18                 590
com.manor.currentwidget.yml                        22-Feb-2021 12:18                4386
com.mantz_it.rfanalyzer.yml                        22-Feb-2021 12:18                3949
com.manuelmaly.hn.yml                              22-Feb-2021 12:18                5706
com.manuelvargastapia.libgen.yml                   22-Feb-2021 12:18                1724
com.mapswithme.maps.libre.yml                      22-Feb-2021 12:18                1439
com.maralexbar.wifikeyview.yml                     22-Feb-2021 12:18                1587
com.marcdonald.hibi.yml                            22-Feb-2021 12:18                 929
com.marceljurtz.lifecounter.yml                    22-Feb-2021 12:18                1057
com.marcospoerl.simplypace.yml                     22-Feb-2021 12:18                 920
com.mareksebera.simpledilbert.yml                  22-Feb-2021 12:18                4263
com.mariogrip.octoprint.yml                        22-Feb-2021 12:18                1047
com.markusborg.test.yml                            22-Feb-2021 12:18                2843
com.markuspage.android.atimetracker.yml            22-Feb-2021 12:18                1401
com.markuspage.android.certtools.yml               22-Feb-2021 12:18                 646
com.martinborjesson.o2xtouchlednotifications.yml   22-Feb-2021 12:18                1249
com.marv42.ebt.newnote.yml                         22-Feb-2021 12:18                1197
com.maskyn.fileeditorpro.yml                       22-Feb-2021 12:18                3699
com.matburt.mobileorg.yml                          22-Feb-2021 12:18                1429
com.matejdro.pebbledialer.yml                      22-Feb-2021 12:18                5354
com.materialos.cm.theme.yml                        22-Feb-2021 12:18                 780
com.mathi_amorim.emmanuel.metrictime.yml           22-Feb-2021 12:18                1015
com.matoski.adbm.yml                               22-Feb-2021 12:18                2047
com.matt.bolton.yml                                22-Feb-2021 12:18                 533
com.matt.outfield.yml                              22-Feb-2021 12:18                 696
com.mattallen.dpixel.yml                           22-Feb-2021 12:18                 597
com.mattallen.loaned.yml                           22-Feb-2021 12:18                 717
com.matteopacini.katana.yml                        22-Feb-2021 12:18                 535
com.mattermost.mattermost.yml                      22-Feb-2021 12:18                1743
com.mattermost.rnbeta.yml                          22-Feb-2021 12:18               23288
com.mattgmg.miracastwidget.yml                     22-Feb-2021 12:18                1349
com.mattieapps.roommates.yml                       22-Feb-2021 12:18                1555
com.mattmaniak.queueToDo.yml                       22-Feb-2021 12:18                 799
com.mattmaniak.rubbishCalc.yml                     22-Feb-2021 12:18                 958
com.max2idea.android.fwknop.yml                    22-Feb-2021 12:18                1036
com.maxfierke.sandwichroulette.yml                 22-Feb-2021 12:18                 923
com.maxfour.music.yml                              22-Feb-2021 12:18                1825
com.maxistar.textpad.yml                           22-Feb-2021 12:18                 731
com.mbestavros.geometricweather.yml                22-Feb-2021 12:18                 625
com.mcsnowflake.worktimer.yml                      22-Feb-2021 12:18                 450
com.mde.potdroid.yml                               22-Feb-2021 12:18                3804
com.mdroid.yml                                     22-Feb-2021 12:18                2555
com.mehmetakiftutuncu.eshotroid.yml                22-Feb-2021 12:18                1169
com.mendhak.gpslogger.yml                          22-Feb-2021 12:18                1786
com.menny.android.anysoftkeyboard.yml              22-Feb-2021 12:18               14619
com.menny.anysoftkeyboard.finnish.yml              22-Feb-2021 12:18                1032
com.metallic.chiaki.yml                            22-Feb-2021 12:18                1751
com.metinkale.prayer.yml                           22-Feb-2021 12:18                7765
com.mfreitas.twister.yml                           22-Feb-2021 12:18                 738
com.mgaetan89.showsrage.yml                        22-Feb-2021 12:18                1996
com.michaldabski.filemanager.yml                   22-Feb-2021 12:18                1413
com.midisheetmusic.yml                             22-Feb-2021 12:18                1124
com.mikifus.padland.yml                            22-Feb-2021 12:18                3550
com.mileskrell.texttorch.yml                       22-Feb-2021 12:18                 947
com.mill_e.twitterwrapper.yml                      22-Feb-2021 12:18                1526
com.minar.birday.yml                               22-Feb-2021 12:18                 923
com.minar.randomix.yml                             22-Feb-2021 12:18                 934
com.miqote.angelplayerwp.yml                       22-Feb-2021 12:18                 633
com.miqote.brswp.yml                               22-Feb-2021 12:18                 687
com.miqote.shanawp.yml                             22-Feb-2021 12:18                 675
com.miracleas.bitcoin_spinner.yml                  22-Feb-2021 12:18                1917
com.mirasmithy.epochlauncher.yml                   22-Feb-2021 12:18                 580
com.mishiranu.dashchan.yml                         22-Feb-2021 12:18                 806
com.mitzuli.yml                                    22-Feb-2021 12:18                4898
com.mkf.droidsat.yml                               22-Feb-2021 12:18                1366
com.mkulesh.micromath.plus.yml                     22-Feb-2021 12:18                4533
com.mkulesh.onpc.yml                               22-Feb-2021 12:18                3998
com.ml.proximitysensorfix.yml                      22-Feb-2021 12:18                 917
com.mmazzarolo.breathly.yml                        22-Feb-2021 12:18                3271
com.mobilepearls.sokoban.yml                       22-Feb-2021 12:18                1889
com.mobiperf.yml                                   22-Feb-2021 12:18                1984
com.mod.android.widget.fbcw.yml                    22-Feb-2021 12:18                 700
com.moez.QKSMS.yml                                 22-Feb-2021 12:18               23073
com.mohammadag.beamfile.yml                        22-Feb-2021 12:18                2388
com.monead.games.android.sequence.yml              22-Feb-2021 12:18                 652
com.money.manager.ex.yml                           22-Feb-2021 12:18                1899
com.mookie.circo.yml                               22-Feb-2021 12:18                1482
com.moonpi.swiftnotes.yml                          22-Feb-2021 12:18                2120
com.moonpi.tapunlock.yml                           22-Feb-2021 12:18                 650
com.morlunk.mountie.yml                            22-Feb-2021 12:18                 912
com.morlunk.mumbleclient.yml                       22-Feb-2021 12:18                4403
com.morphoss.acal.yml                              22-Feb-2021 12:18                2802
com.movim.movim.yml                                22-Feb-2021 12:18                2132
com.mp3tunes.android.player.yml                    22-Feb-2021 12:18                 893
com.mrbimc.selinux.yml                             22-Feb-2021 12:18                1198
com.mridang.cellinfo.yml                           22-Feb-2021 12:18                 919
com.mridang.speedo.yml                             22-Feb-2021 12:18                 528
com.mridang.throttle.yml                           22-Feb-2021 12:18                 714
com.mridang.wifiinfo.yml                           22-Feb-2021 12:18                1000
com.msapps.touchdetector.yml                       22-Feb-2021 12:18                 549
com.mschlauch.comfortreader.yml                    22-Feb-2021 12:18                2166
com.murrayc.galaxyzoo.app.yml                      22-Feb-2021 12:18                8229
com.mustafaali.sensorssandbox.yml                  22-Feb-2021 12:18                 904
com.mustupid.metronome.yml                         22-Feb-2021 12:18                 703
com.mustupid.pitch_pipe.yml                        22-Feb-2021 12:18                 654
com.mykola.lexinproject.yml                        22-Feb-2021 12:18                 751
com.myopicmobile.textwarrior.android.yml           22-Feb-2021 12:18                 957
com.mystro256.autooffbluetooth.yml                 22-Feb-2021 12:18                 669
com.mzhang.cleantimer.yml                          22-Feb-2021 12:18                 448
com.nagopy.android.disablemanager2.yml             22-Feb-2021 12:18                1540
com.naholyr.android.horairessncf.yml               22-Feb-2021 12:18                 802
com.naman14.stools.yml                             22-Feb-2021 12:18                 772
com.namelessdev.mpdroid.yml                        22-Feb-2021 12:18                3186
com.namsor.api.samples.gendre.yml                  22-Feb-2021 12:18                1474
com.nanoconverter.zlab.yml                         22-Feb-2021 12:18                1182
com.nathaniel.motus.cavevin.yml                    22-Feb-2021 12:18                 688
com.nathanosman.chronosnap.yml                     22-Feb-2021 12:18                 881
com.nauj27.android.colorpicker.yml                 22-Feb-2021 12:18                 818
com.nazmar.dicegainz.yml                           22-Feb-2021 12:18                 663
com.nbossard.packlist.yml                          22-Feb-2021 12:18                2058
com.nephi.getoffyourphone.yml                      22-Feb-2021 12:18                1623
com.nephoapp.anarxiv.yml                           22-Feb-2021 12:18                 404
com.nesswit.galbijjimsearcher.yml                  22-Feb-2021 12:18                 870
com.netthreads.android.noiz2.yml                   22-Feb-2021 12:18                 692
com.newsblur.yml                                   22-Feb-2021 12:18               37975
com.nexes.manager.yml                              22-Feb-2021 12:18                 783
com.nextcloud.android.beta.yml                     22-Feb-2021 12:18              147038
com.nextcloud.client.yml                           22-Feb-2021 12:18               31184
com.nextcloud.talk2.yml                            22-Feb-2021 12:18               10408
com.nextcloudpasswords.yml                         22-Feb-2021 12:18                3299
com.nextgis.mobile.yml                             22-Feb-2021 12:18                1811
com.nhellfire.kerneladiutor.yml                    22-Feb-2021 12:18                1461
com.nicobrailo.pianoli.yml                         22-Feb-2021 12:18                1902
com.nicolasbrailo.vlcfreemote.yml                  22-Feb-2021 12:18                1469
com.nicue.onetwo.yml                               22-Feb-2021 12:18                1712
com.nightshadelabs.anotherbrowser.yml              22-Feb-2021 12:18                 751
com.nikhiljha.lobstersapp.yml                      22-Feb-2021 12:18                 831
com.nikola.jakshic.dagger.yml                      22-Feb-2021 12:18                 994
com.nilhcem.frcndict.yml                           22-Feb-2021 12:18                 947
com.nilhcem.hostseditor.yml                        22-Feb-2021 12:18                1168
com.niparasc.papanikolis.yml                       22-Feb-2021 12:18                 841
com.nishantboro.splititeasy.yml                    22-Feb-2021 12:18                 542
com.nkanaev.comics.yml                             22-Feb-2021 12:18                1291
com.nltechno.dolidroidpro.yml                      22-Feb-2021 12:18                2698
com.nma.util.sdcardtrac.yml                        22-Feb-2021 12:18                1634
com.noahjutz.splitfit.fdroid.yml                   22-Feb-2021 12:18                 992
com.nolanlawson.apptracker.yml                     22-Feb-2021 12:18                 887
com.nolanlawson.chordreader.yml                    22-Feb-2021 12:18                 943
com.nolanlawson.jnameconverter.yml                 22-Feb-2021 12:18                1100
com.nolanlawson.keepscore.yml                      22-Feb-2021 12:18                1919
com.nolanlawson.logcat.yml                         22-Feb-2021 12:18                1127
com.nomadlabs.labcoat.deeplinks.yml                22-Feb-2021 12:18                1040
com.nononsenseapps.feeder.yml                      22-Feb-2021 12:18               14648
com.nononsenseapps.notepad.yml                     22-Feb-2021 12:18                5457
com.nononsenseapps.wanidoku.yml                    22-Feb-2021 12:18                 909
com.noprestige.kanaquiz.yml                        22-Feb-2021 12:18                1345
com.noshufou.android.su.yml                        22-Feb-2021 12:18                1401
com.nostra13.universalimageloader.yml              22-Feb-2021 12:18                 980
com.notecryptpro.yml                               22-Feb-2021 12:18                1730
com.notriddle.budget.yml                           22-Feb-2021 12:18                1778
com.notriddle.null_launcer.yml                     22-Feb-2021 12:18                1274
com.nowsecure.android.vts.yml                      22-Feb-2021 12:18                1251
com.nucc.hackwinds.yml                             22-Feb-2021 12:18                3828
com.numguesser.tonio_rpchp.numberguesser.yml       22-Feb-2021 12:18                1992
com.numix.calculator.yml                           22-Feb-2021 12:18                2838
com.numix.icons_circle.yml                         22-Feb-2021 12:18                3816
com.nutomic.ensichat.yml                           22-Feb-2021 12:18                2716
com.nutomic.syncthingandroid.yml                   22-Feb-2021 12:18               35996
com.nutomic.zertman.yml                            22-Feb-2021 12:18                1015
com.oF2pks.adbungfu.yml                            22-Feb-2021 12:18                2470
com.oF2pks.applicationsinfo.yml                    22-Feb-2021 12:18                1895
com.oF2pks.chairlock.yml                           22-Feb-2021 12:18                1591
com.oF2pks.classyshark3xodus.yml                   22-Feb-2021 12:18                6904
com.oF2pks.jquarks.yml                             22-Feb-2021 12:18                1481
com.oF2pks.kalturadeviceinfos.yml                  22-Feb-2021 12:18                2402
com.oF2pks.neolinker.yml                           22-Feb-2021 12:18                1473
com.oF2pks.netscope.yml                            22-Feb-2021 12:18                1106
com.oakley.fon.yml                                 22-Feb-2021 12:18                1591
com.oasisfeng.island.fdroid.yml                    22-Feb-2021 12:18                6615
com.odnovolov.forgetmenot.yml                      22-Feb-2021 12:18                 828
com.ogsdroid.yml                                   22-Feb-2021 12:18                1519
com.olam.yml                                       22-Feb-2021 12:18                 650
com.omegavesko.holocounter.yml                     22-Feb-2021 12:18                 872
com.omegavesko.sutransplus.yml                     22-Feb-2021 12:18                 773
com.omgodse.notally.yml                            22-Feb-2021 12:18                 828
com.oml.recordtimedroid.yml                        22-Feb-2021 12:18                 741
com.onest8.onetimepad.yml                          22-Feb-2021 12:18                1405
com.onetwofivegames.kungfoobarracuda.yml           22-Feb-2021 12:18                1289
com.opendoorstudios.ds4droid.yml                   22-Feb-2021 12:18                7597
com.openpi.spellingwizard.yml                      22-Feb-2021 12:18                1000
com.opentaxi.android.yml                           22-Feb-2021 12:18                 967
com.orgzly.yml                                     22-Feb-2021 12:18                4995
com.oriondev.moneywallet.yml                       22-Feb-2021 12:18                2528
com.orphan.amplayer.yml                            22-Feb-2021 12:18                1071
com.orpheusdroid.screenrecorder.yml                22-Feb-2021 12:18                5015
com.orpheusdroid.sqliteviewer.yml                  22-Feb-2021 12:18                1516
com.osfans.trime.yml                               22-Feb-2021 12:18                1303
com.otago.open.yml                                 22-Feb-2021 12:18                 548
com.outdoordevs.ellaism.wallet.yml                 22-Feb-2021 12:18                1107
com.outerworldapps.wairtonow.yml                   22-Feb-2021 12:18                 783
com.owncloud.android.yml                           22-Feb-2021 12:18               16093
com.packetsender.android.yml                       22-Feb-2021 12:18                1655
com.palliser.nztides.yml                           22-Feb-2021 12:18                1657
com.panaceasupplies.android.games.toytrain.yml     22-Feb-2021 12:18                 697
com.paranoid.ParanoidWallpapers.yml                22-Feb-2021 12:18                1856
com.passcard.yml                                   22-Feb-2021 12:18                1769
com.pavelsikun.runinbackgroundpermissionsetter.yml 22-Feb-2021 12:18                1770
com.pcinpact.yml                                   22-Feb-2021 12:18                2143
com.peppercarrot.runninggame.yml                   22-Feb-2021 12:18                1206
com.perflyst.twire.yml                             22-Feb-2021 12:18                2790
com.perol.asdpl.play.pixivez.libre.yml             22-Feb-2021 12:18                1003
com.pheelicks.visualizer.yml                       22-Feb-2021 12:18                 740
com.phg.constellations.yml                         22-Feb-2021 12:18                 592
com.phikal.regex.yml                               22-Feb-2021 12:18                1721
com.philliphsu.clock2.yml                          22-Feb-2021 12:18                1712
com.philolog.hoplitekeyboard.yml                   22-Feb-2021 12:18                1459
com.phpsysinfo.yml                                 22-Feb-2021 12:18                1962
com.physphil.android.unitconverterultimate.yml     22-Feb-2021 12:18                6738
com.pi.attestation.yml                             22-Feb-2021 12:18                 756
com.picross.nonocross.yml                          22-Feb-2021 12:18                 670
com.pierceholdings.dontpause.yml                   22-Feb-2021 12:18                 771
com.pierreduchemin.punchlinebingo.yml              22-Feb-2021 12:18                 782
com.pierreduchemin.smsforward.yml                  22-Feb-2021 12:18                1172
com.pikselbit.wrongpinshutdown.yml                 22-Feb-2021 12:18                 895
com.pilockerstable.yml                             22-Feb-2021 12:18                 985
com.pilot51.voicenotify.yml                        22-Feb-2021 12:18                2124
com.pindroid.yml                                   22-Feb-2021 12:18                2504
com.piratebayfree.yml                              22-Feb-2021 12:18                1517
com.pitchedapps.frost.yml                          22-Feb-2021 12:18                2493
com.piwi.stickeroid.yml                            22-Feb-2021 12:18                 597
com.pixiv.muzei.pixivsource.yml                    22-Feb-2021 12:18                2300
com.pjuu.droidotter.yml                            22-Feb-2021 12:18                1515
com.pjuu.otterdroid.yml                            22-Feb-2021 12:18                 944
com.planes.android.yml                             22-Feb-2021 12:18                1206
com.platypus.SAnd.yml                              22-Feb-2021 12:18                1384
com.platypus.dicer.yml                             22-Feb-2021 12:18                 951
com.pluscubed.matloglibre.yml                      22-Feb-2021 12:18                2270
com.plusonelabs.calendar.yml                       22-Feb-2021 12:18                5682
com.podverse.fdroid.yml                            22-Feb-2021 12:18                3607
com.poinsart.votar.yml                             22-Feb-2021 12:18                1158
com.polipoid.yml                                   22-Feb-2021 12:18                5469
com.politedroid.yml                                22-Feb-2021 12:18                 821
com.poloure.simplerss.yml                          22-Feb-2021 12:18                 552
com.poupa.attestationdeplacement.yml               22-Feb-2021 12:18                1923
com.poupa.vinylmusicplayer.yml                     22-Feb-2021 12:18                2867
com.powerje.nyan.yml                               22-Feb-2021 12:18                 982
com.powerpoint45.lucidbrowser.yml                  22-Feb-2021 12:18                 993
com.practicalapps.hamtrainer.yml                   22-Feb-2021 12:18                 995
com.prangesoftwaresolutions.audioanchor.yml        22-Feb-2021 12:18                2164
com.prhlt.aemus.Read4SpeechExperiments.yml         22-Feb-2021 12:18                1905
com.primavera.arduino.listener.yml                 22-Feb-2021 12:18                 816
com.primokorn.enhancement.yml                      22-Feb-2021 12:18                2702
com.proch.practicehub.yml                          22-Feb-2021 12:18                 917
com.procrastimax.birthdaybuddy.yml                 22-Feb-2021 12:18                1206
com.projectsexception.myapplist.open.yml           22-Feb-2021 12:18                 951
com.punksta.apps.volumecontrol.yml                 22-Feb-2021 12:18                1255
com.purplefoto.pfdock.yml                          22-Feb-2021 12:18                1355
com.pvpc.precio_luz.yml                            22-Feb-2021 12:18                1453
com.qsp.player.yml                                 22-Feb-2021 12:18                 853
com.quaap.audiometer.yml                           22-Feb-2021 12:18                1592
com.quaap.bookymcbookface.yml                      22-Feb-2021 12:18                1391
com.quaap.computationaldemonology.yml              22-Feb-2021 12:18                1021
com.quaap.dodatheexploda.yml                       22-Feb-2021 12:18                1166
com.quaap.fishberserker.yml                        22-Feb-2021 12:18                 954
com.quaap.launchtime.yml                           22-Feb-2021 12:18                2734
com.quaap.phonefonefun.yml                         22-Feb-2021 12:18                1033
com.quaap.primary.yml                              22-Feb-2021 12:18                1441
com.qubling.sidekick.yml                           22-Feb-2021 12:18                1447
com.quchen.flashcard.yml                           22-Feb-2021 12:18                 602
com.quinncasey.paperless_share.yml                 22-Feb-2021 12:18                1081
com.quran.labs.androidquran.yml                    22-Feb-2021 12:18                1543
com.radioreddit.android.yml                        22-Feb-2021 12:18                 952
com.radiostudent.radiostudentstream.yml            22-Feb-2021 12:18                 708
com.rareventure.gps2.yml                           22-Feb-2021 12:18               19626
com.rascarlo.adaptive.brightness.tile.yml          22-Feb-2021 12:18                1153
com.rascarlo.arch.packages.yml                     22-Feb-2021 12:18                 855
com.rascarlo.aurdroid.yml                          22-Feb-2021 12:18                2275
com.rascarlo.power.button.tile.yml                 22-Feb-2021 12:18                 524
com.rastating.droidbeard.yml                       22-Feb-2021 12:18                2856
com.ratebeer.android.yml                           22-Feb-2021 12:18                1044
com.readrops.app.yml                               22-Feb-2021 12:18                1233
com.readystatesoftware.ghostlog.yml                22-Feb-2021 12:18                1335
com.rechnen.app.yml                                22-Feb-2021 12:18                 903
com.redblaster.hsl.main.yml                        22-Feb-2021 12:18                 975
com.redcoracle.episodes.yml                        22-Feb-2021 12:18                 727
com.reddyetwo.hashmypass.app.yml                   22-Feb-2021 12:18                2659
com.redirectapps.tvkill.yml                        22-Feb-2021 12:18                2673
com.refactech.driibo.yml                           22-Feb-2021 12:18                 904
com.rehanced.lunary.yml                            22-Feb-2021 12:18                3497
com.reicast.emulator.yml                           22-Feb-2021 12:18                1036
com.releasestandard.scriptmanager.yml              22-Feb-2021 12:18                 923
com.reminimalism.materialslivewallpaper.yml        22-Feb-2021 12:18                 897
com.repay.android.yml                              22-Feb-2021 12:18                 928
com.replica.replicaisland.yml                      22-Feb-2021 12:18                 665
com.rfo.LASKmobile.yml                             22-Feb-2021 12:18                 618
com.rfo.basic.yml                                  22-Feb-2021 12:18                 571
com.rhiannonweb.android.migrainetracker.yml        22-Feb-2021 12:18                1194
com.ridgelineapps.resdicegame.yml                  22-Feb-2021 12:18                1105
com.rigid.birthdroid.yml                           22-Feb-2021 12:18                1672
com.ringdroid.yml                                  22-Feb-2021 12:18                 995
com.rj.pixelesque.yml                              22-Feb-2021 12:18                1205
com.robert.maps.yml                                22-Feb-2021 12:18                2657
com.rockbyte.arxiv.yml                             22-Feb-2021 12:18                1645
com.rogerbassonsrenart.paddletennis.yml            22-Feb-2021 12:18                1179
com.roguetemple.hydroid.yml                        22-Feb-2021 12:18                 799
com.roguetemple.hyperroid.yml                      22-Feb-2021 12:18                3432
com.rohit2810.spotit.yml                           22-Feb-2021 12:18                 658
com.rohitsuratekar.NCBSinfo.yml                    22-Feb-2021 12:18                 613
com.roozen.SoundManagerv2.yml                      22-Feb-2021 12:18                 620
com.rtbishop.look4sat.yml                          22-Feb-2021 12:18                 985
com.rubenroy.minimaltodo.yml                       22-Feb-2021 12:18                 584
com.rubenwardy.minetestmodmanager.yml              22-Feb-2021 12:18                2261
com.ruesga.android.wallpapers.photophase.yml       22-Feb-2021 12:18                3535
com.ruesga.rview.yml                               22-Feb-2021 12:18                 636
com.ruqqienav.yml                                  22-Feb-2021 12:18                 455
com.sagar.screenshift2.yml                         22-Feb-2021 12:18                1055
com.saha.batchuninstaller.yml                      22-Feb-2021 12:18                1396
com.sahdeepsingh.Bop.yml                           22-Feb-2021 12:18                2237
com.saibotd.bitbeaker.yml                          22-Feb-2021 12:18                1583
com.saiga.find.messagefinder.yml                   22-Feb-2021 12:18                 679
com.sakthipriyan.cricscore.yml                     22-Feb-2021 12:18                 911
com.saladdressing.veterondo.yml                    22-Feb-2021 12:18                1716
com.sam.hex.yml                                    22-Feb-2021 12:18                1332
com.samarthdesai.repeatme.yml                      22-Feb-2021 12:18                1798
com.samco.trackandgraph.yml                        22-Feb-2021 12:18                1586
com.samebits.beacon.locator.yml                    22-Feb-2021 12:18                3220
com.samsandberg.mtafarebuster.yml                  22-Feb-2021 12:18                1745
com.samsung.srpol.yml                              22-Feb-2021 12:18                 901
com.sandeel.bushidoblocks.yml                      22-Feb-2021 12:18                1616
com.sanskritbasics.memory.yml                      22-Feb-2021 12:18                1077
com.sanskritbasics.yml                             22-Feb-2021 12:18                 575
com.sapientech.mediagoblin.yml                     22-Feb-2021 12:18                 786
com.sapos_aplastados.game.clash_of_balls.yml       22-Feb-2021 12:18                2005
com.sapuseven.untis.yml                            22-Feb-2021 12:18                1818
com.scar45.aokp.co.webviewer.yml                   22-Feb-2021 12:18                 594
com.scottmain.android.searchlight.yml              22-Feb-2021 12:18                 804
com.scraperclub.android.yml                        22-Feb-2021 12:18                 643
com.sduduzog.slimlauncher.yml                      22-Feb-2021 12:18                2930
com.seafile.seadroid.yml                           22-Feb-2021 12:18                1334
com.seafile.seadroid2.yml                          22-Feb-2021 12:18               35661
com.seavenois.tetris.yml                           22-Feb-2021 12:18                 491
com.seawolfsanctuary.keepingtracks.yml             22-Feb-2021 12:18                4694
com.seb.SLWP.yml                                   22-Feb-2021 12:18                 863
com.seb.SLWPmaps.yml                               22-Feb-2021 12:18                 568
com.securefilemanager.app.yml                      22-Feb-2021 12:18                 645
com.secuso.privacyFriendlyCodeScanner.yml          22-Feb-2021 12:18                2251
com.secuso.torchlight2.yml                         22-Feb-2021 12:18                 988
com.selbie.wrek.yml                                22-Feb-2021 12:18                 980
com.selesca.xkcdmuzei.yml                          22-Feb-2021 12:18                 641
com.semche.invasion.yml                            22-Feb-2021 12:18                 602
com.sensirion.smartgadget.yml                      22-Feb-2021 12:18                1751
com.sentienhq.launcher.yml                         22-Feb-2021 12:18                 605
com.serone.desktoplabel.yml                        22-Feb-2021 12:18                 417
com.servoz.appsdisabler.yml                        22-Feb-2021 12:18                1441
com.serwylo.babydots.yml                           22-Feb-2021 12:18                1142
com.serwylo.beatgame.yml                           22-Feb-2021 12:18                 548
com.serwylo.lexica.yml                             22-Feb-2021 12:18                3425
com.serwylo.msjviewer.yml                          22-Feb-2021 12:18                1257
com.sevag.pitcha.yml                               22-Feb-2021 12:18                 835
com.sevag.unrealtracker.yml                        22-Feb-2021 12:18                 852
com.sgr_b2.compass.yml                             22-Feb-2021 12:18                1675
com.shadcat.secdroid.yml                           22-Feb-2021 12:18                1295
com.shahul3d.indiasatelliteweather.yml             22-Feb-2021 12:18                1918
com.shanewmiller.gorecompanion.yml                 22-Feb-2021 12:18                 688
com.shapps.mintubeapp.yml                          22-Feb-2021 12:18                2149
com.shatteredpixel.shatteredpixeldungeon.yml       22-Feb-2021 12:18               20676
com.shkmishra.lyrically.yml                        22-Feb-2021 12:18                2100
com.showmehills.yml                                22-Feb-2021 12:18                3657
com.shurik.droidzebra.yml                          22-Feb-2021 12:18                1499
com.sidzi.circleofmusic.yml                        22-Feb-2021 12:18                 689
com.sigmarelax.doitoscihub.yml                     22-Feb-2021 12:18                2225
com.sigseg.android.worldmap.yml                    22-Feb-2021 12:18                1445
com.silentlexx.instead.yml                         22-Feb-2021 12:18                1430
com.silverkeytech.android_rivers.yml               22-Feb-2021 12:18                 729
com.simonramstedt.yoke.yml                         22-Feb-2021 12:18                1050
com.simplecity.amp_pro.yml                         22-Feb-2021 12:18                 552
com.simpledecredwidget.yml                         22-Feb-2021 12:18                 728
com.simplemobiletools.applauncher.yml              22-Feb-2021 12:18                5154
com.simplemobiletools.calculator.yml               22-Feb-2021 12:18                4205
com.simplemobiletools.calendar.pro.yml             22-Feb-2021 12:18                9056
com.simplemobiletools.calendar.yml                 22-Feb-2021 12:18               12693
com.simplemobiletools.camera.yml                   22-Feb-2021 12:18                6902
com.simplemobiletools.clock.yml                    22-Feb-2021 12:18                3219
com.simplemobiletools.contacts.pro.yml             22-Feb-2021 12:18                6676
com.simplemobiletools.contacts.yml                 22-Feb-2021 12:18                4152
com.simplemobiletools.dialer.yml                   22-Feb-2021 12:18                3458
com.simplemobiletools.draw.pro.yml                 22-Feb-2021 12:18                3492
com.simplemobiletools.draw.yml                     22-Feb-2021 12:18                4445
com.simplemobiletools.filemanager.pro.yml          22-Feb-2021 12:18                5969
com.simplemobiletools.filemanager.yml              22-Feb-2021 12:18               16453
com.simplemobiletools.flashlight.yml               22-Feb-2021 12:18                4787
com.simplemobiletools.gallery.pro.yml              22-Feb-2021 12:18               14850
com.simplemobiletools.gallery.yml                  22-Feb-2021 12:18               16241
com.simplemobiletools.musicplayer.yml              22-Feb-2021 12:18                9409
com.simplemobiletools.notes.pro.yml                22-Feb-2021 12:18                4799
com.simplemobiletools.notes.yml                    22-Feb-2021 12:18                5423
com.simplemobiletools.smsmessenger.yml             22-Feb-2021 12:18                4531
com.simplemobiletools.thankyou.yml                 22-Feb-2021 12:18                3041
com.simplemobiletools.voicerecorder.yml            22-Feb-2021 12:18                2285
com.sinpo.xnfc.yml                                 22-Feb-2021 12:18                 871
com.sismics.reader.yml                             22-Feb-2021 12:18                2036
com.slash.batterychargelimit.yml                   22-Feb-2021 12:18                2029
com.sleeptimer.yml                                 22-Feb-2021 12:18                 648
com.sli.juicymobile.yml                            22-Feb-2021 12:18                 640
com.sli.ohmcalc.yml                                22-Feb-2021 12:18                 498
com.slothwerks.hearthstone.compendiumforhearths..> 22-Feb-2021 12:18                 740
com.smartpack.kernelmanager.yml                    22-Feb-2021 12:18                1535
com.smartpack.kernelprofiler.yml                   22-Feb-2021 12:18                 752
com.smartpack.packagemanager.yml                   22-Feb-2021 12:18                1045
com.smartpack.scriptmanager.yml                    22-Feb-2021 12:18                 949
com.smartpack.smartflasher.yml                     22-Feb-2021 12:18                 757
com.smerty.ham.yml                                 22-Feb-2021 12:18                1092
com.smilla.greentooth.yml                          22-Feb-2021 12:18                1134
com.smithdtyler.prettygoodmusicplayer.launcherm..> 22-Feb-2021 12:18                2136
com.smithdtyler.prettygoodmusicplayer.yml          22-Feb-2021 12:18                3779
com.smorgasbork.hotdeath.yml                       22-Feb-2021 12:18                 908
com.snaheth.trulyrandom.yml                        22-Feb-2021 12:18                 742
com.sound.ampache.yml                              22-Feb-2021 12:18                 737
com.sovworks.edslite.yml                           22-Feb-2021 12:18                1015
com.soyblue.bluesound.yml                          22-Feb-2021 12:18                2732
com.spazedog.mounts2sd.yml                         22-Feb-2021 12:18                1946
com.spisoft.quicknote.yml                          22-Feb-2021 12:18               12104
com.sputnik.wispr.yml                              22-Feb-2021 12:18                 844
com.spydiko.rotationmanager_foss.yml               22-Feb-2021 12:18                 809
com.ssaurel.clocklw.yml                            22-Feb-2021 12:18                 626
com.standardnotes.yml                              22-Feb-2021 12:18                6099
com.starapps.tools.tnefextractor.yml               22-Feb-2021 12:18                 612
com.stealthcotper.networktools.yml                 22-Feb-2021 12:18                 772
com.stonegate.tsacdop.yml                          22-Feb-2021 12:18                1152
com.stoutner.privacybrowser.standard.yml           22-Feb-2021 12:18                8815
com.stripe1.xmouse.yml                             22-Feb-2021 12:18                1387
com.studio332.flickit.android.yml                  22-Feb-2021 12:18                1269
com.studio332.flickit.yml                          22-Feb-2021 12:18                1557
com.stwalkerster.android.apps.strobelight.yml      22-Feb-2021 12:18                 659
com.stypox.mastercom_workbook.yml                  22-Feb-2021 12:18                 853
com.styrkurapp.app.yml                             22-Feb-2021 12:18                1215
com.sunilpaulmathew.debloater.yml                  22-Feb-2021 12:18                1287
com.sunilpaulmathew.translator.yml                 22-Feb-2021 12:18                1154
com.sunshine.makilite.yml                          22-Feb-2021 12:18                1213
com.sunyata.kindmind.yml                           22-Feb-2021 12:18                1149
com.superproductivity.superproductivity.yml        22-Feb-2021 12:18                 640
com.suyashsrijan.forcedoze.yml                     22-Feb-2021 12:18                1666
com.sweetiepiggy.everylocale.yml                   22-Feb-2021 12:18                 835
com.swiss.tournament.yml                           22-Feb-2021 12:18                1096
com.swordfish.lemuroid.yml                         22-Feb-2021 12:18                1098
com.syncedsynapse.kore2.yml                        22-Feb-2021 12:18                1593
com.szchoiceway.aios.bridge.yml                    22-Feb-2021 12:18                 545
com.tachibana.downloader.yml                       22-Feb-2021 12:18                1347
com.tailscale.ipn.yml                              22-Feb-2021 12:18                5283
com.taiste.lainari_en.yml                          22-Feb-2021 12:18                1636
com.tananaev.calculator.yml                        22-Feb-2021 12:18                1188
com.tananaev.logcat.yml                            22-Feb-2021 12:18                2217
com.tasomaniac.dashclock.hackerspace.floss.yml     22-Feb-2021 12:18                 688
com.tasomaniac.openwith.floss.yml                  22-Feb-2021 12:18                3022
com.tastycactus.timesheet.yml                      22-Feb-2021 12:18                 814
com.teamdc.stephendiniz.autoaway.yml               22-Feb-2021 12:18                1058
com.teleca.jamendo.yml                             22-Feb-2021 12:18                1646
com.templaro.opsiz.aka.yml                         22-Feb-2021 12:18                1055
com.ten15.diyfish.yml                              22-Feb-2021 12:18                 545
com.tengu.sharetoclipboard.yml                     22-Feb-2021 12:18                3860
com.termoneplus.yml                                22-Feb-2021 12:18                2821
com.termux.api.yml                                 22-Feb-2021 12:18                6941
com.termux.boot.yml                                22-Feb-2021 12:18                1810
com.termux.nix.yml                                 22-Feb-2021 12:18                1697
com.termux.styling.yml                             22-Feb-2021 12:18                2720
com.termux.tasker.yml                              22-Feb-2021 12:18                1464
com.termux.widget.yml                              22-Feb-2021 12:18                1633
com.termux.window.yml                              22-Feb-2021 12:18                1309
com.termux.yml                                     22-Feb-2021 12:18               11396
com.textuality.lifesaver2.yml                      22-Feb-2021 12:18                1098
com.th.XenonWallpapers.yml                         22-Feb-2021 12:18                1476
com.thechiefmeat.freetusky.yml                     22-Feb-2021 12:18                 458
com.thefonz.ed_tool.yml                            22-Feb-2021 12:18                 737
com.thehoick.evergreenwishlist.yml                 22-Feb-2021 12:18                1498
com.theksmith.android.car_bus_interface.yml        22-Feb-2021 12:18                1148
com.thermatk.android.xf.fakegapps.yml              22-Feb-2021 12:18                1034
com.theworld.help.cbtandroid.yml                   22-Feb-2021 12:18                1003
com.thibaudperso.sonycamera.yml                    22-Feb-2021 12:18                2348
com.thirtydegreesray.openhub.yml                   22-Feb-2021 12:18                1288
com.threedlite.livePolys.yml                       22-Feb-2021 12:18                 494
com.threedlite.urforms.yml                         22-Feb-2021 12:18                1308
com.threedlite.userhash.location.yml               22-Feb-2021 12:18                 939
com.tht.k3pler.yml                                 22-Feb-2021 12:18                 963
com.tierep.notificationanalyser.yml                22-Feb-2021 12:18                1537
com.timvdalen.gizmooi.yml                          22-Feb-2021 12:18                 475
com.tinkerlog.android.pongtime.yml                 22-Feb-2021 12:18                 727
com.tistory.deque.previewmaker.yml                 22-Feb-2021 12:18                 624
com.tiwa.pl.yml                                    22-Feb-2021 12:18                 748
com.tjk104.openfndds.yml                           22-Feb-2021 12:18                 501
com.tjm.crushr.yml                                 22-Feb-2021 12:18                 671
com.tjm.stripepaper.yml                            22-Feb-2021 12:18                 738
com.tkjelectronics.balanduino.yml                  22-Feb-2021 12:18                1987
com.tmarki.comicmaker.yml                          22-Feb-2021 12:18                1458
com.tmendes.birthdaydroid.yml                      22-Feb-2021 12:18                3868
com.tmendes.dadosd.yml                             22-Feb-2021 12:18                 865
com.tnc.android.graphite.yml                       22-Feb-2021 12:18                 931
com.tnibler.cryptocam.yml                          22-Feb-2021 12:18                1329
com.tobiaskuban.android.monthcalendarwidgetfoss..> 22-Feb-2021 12:18                 825
com.tobykurien.batteryfu.yml                       22-Feb-2021 12:18                1954
com.tobykurien.google_news.yml                     22-Feb-2021 12:18                2081
com.tobykurien.webapps.yml                         22-Feb-2021 12:18                7182
com.tobykurien.webmediashare.yml                   22-Feb-2021 12:18                1447
com.todobom.opennotescanner.yml                    22-Feb-2021 12:18                6314
com.tomaszmarzeion.notepad.yml                     22-Feb-2021 12:18                 937
com.tomatodev.timerdroid.yml                       22-Feb-2021 12:18                 878
com.tomer.alwayson.yml                             22-Feb-2021 12:18                2730
com.tomer.dbz.widget.yml                           22-Feb-2021 12:18                 862
com.tomer.draw.yml                                 22-Feb-2021 12:18                1092
com.tomer.poke.notifier.yml                        22-Feb-2021 12:18                1280
com.tomer.screenshotsharer.yml                     22-Feb-2021 12:18                1082
com.tortel.syslog.yml                              22-Feb-2021 12:18                3060
com.tortuca.holoken.yml                            22-Feb-2021 12:18                 834
com.totsp.bookworm.yml                             22-Feb-2021 12:18                 879
com.totsp.crossword.shortyz.yml                    22-Feb-2021 12:18                4202
com.toxtox.philosopherstonewidget.yml              22-Feb-2021 12:18                 825
com.traffar.a24game.yml                            22-Feb-2021 12:18                3335
com.traffar.game_of_life.yml                       22-Feb-2021 12:18                3542
com.traffar.gomoku.yml                             22-Feb-2021 12:18                4268
com.traffar.oware.yml                              22-Feb-2021 12:18                1033
com.traffar.pentago.yml                            22-Feb-2021 12:18                1886
com.transway.caresteouvert.yml                     22-Feb-2021 12:18                1120
com.tritop.androsense2.yml                         22-Feb-2021 12:18                 900
com.truchsess.send2car.yml                         22-Feb-2021 12:18                 586
com.tss.android.yml                                22-Feb-2021 12:18                 583
com.tttdevs.stncbookmarks.yml                      22-Feb-2021 12:18                1137
com.tum.yahtzee.yml                                22-Feb-2021 12:18                 517
com.tunerly.yml                                    22-Feb-2021 12:18                1684
com.tunes.viewer.yml                               22-Feb-2021 12:18                1201
com.tunjid.fingergestures.yml                      22-Feb-2021 12:18                3580
com.turtleplayerv2.yml                             22-Feb-2021 12:18                 624
com.tutpro.baresip.plus.yml                        22-Feb-2021 12:18               13653
com.tutpro.baresip.yml                             22-Feb-2021 12:18               40080
com.twidere.twiderex.yml                           22-Feb-2021 12:18                1198
com.twinone.locker.yml                             22-Feb-2021 12:18                1285
com.twistedplane.sealnote.yml                      22-Feb-2021 12:18                1250
com.twobuntu.twobuntu.yml                          22-Feb-2021 12:18                1126
com.twofours.surespot.yml                          22-Feb-2021 12:18                7587
com.twolinessoftware.android.yml                   22-Feb-2021 12:18                 796
com.twsitedapps.homemanager.yml                    22-Feb-2021 12:18                 773
com.u17od.upm.yml                                  22-Feb-2021 12:18                 871
com.u2fa.secur.yml                                 22-Feb-2021 12:18                 991
com.ubergeek42.WeechatAndroid.yml                  22-Feb-2021 12:18                3777
com.uberspot.a2048.yml                             22-Feb-2021 12:18                1535
com.ubuntuone.android.files.yml                    22-Feb-2021 12:18                2241
com.ulicae.cinelog.yml                             22-Feb-2021 12:18                2249
com.ultrafunk.network_info.yml                     22-Feb-2021 12:18                3967
com.ultramegasoft.flavordex2.yml                   22-Feb-2021 12:18                 643
com.ultramegatech.ey.yml                           22-Feb-2021 12:18                3473
com.umang.dashnotifier.yml                         22-Feb-2021 12:18                1764
com.unciv.app.yml                                  22-Feb-2021 12:18               26611
com.unitedcoders.android.gpodroid.yml              22-Feb-2021 12:18                 701
com.unleashyouradventure.swaccess.yml              22-Feb-2021 12:18                3011
com.unwind.networkmonitor.yml                      22-Feb-2021 12:18                 701
com.unwrappedapps.android.wallpaper.creative.yml   22-Feb-2021 12:18                 914
com.uploadedlobster.PwdHash.yml                    22-Feb-2021 12:18                1715
com.uraroji.garage.android.mp3recvoice.yml         22-Feb-2021 12:18                1067
com.urbandroid.dontkillmyapp.yml                   22-Feb-2021 12:18                 582
com.ushahidi.android.app.yml                       22-Feb-2021 12:18                2406
com.utazukin.ichaival.yml                          22-Feb-2021 12:18                1939
com.utyf.pmetro.yml                                22-Feb-2021 12:18                1691
com.vackosar.searchbasedlauncher.yml               22-Feb-2021 12:18                2420
com.vadimfrolov.duorem.yml                         22-Feb-2021 12:18                1742
com.valleytg.oasvn.android.yml                     22-Feb-2021 12:18                1413
com.vanderbie.heart_rate_monitor.yml               22-Feb-2021 12:18                 619
com.vecturagames.android.app.passwordgenerator.yml 22-Feb-2021 12:18                 629
com.vecturagames.android.app.passwordmaster.yml    22-Feb-2021 12:18                 611
com.vedroid.events.yml                             22-Feb-2021 12:18                 521
com.veken0m.bitcoinium.yml                         22-Feb-2021 12:18                3458
com.veniosg.dir.yml                                22-Feb-2021 12:18                1484
com.vgorcum.minedmonero.yml                        22-Feb-2021 12:18                 764
com.vincent_falzon.discreetlauncher.yml            22-Feb-2021 12:18                 586
com.viper.simplert.yml                             22-Feb-2021 12:18                1118
com.vlath.beheexplorer.yml                         22-Feb-2021 12:18                1399
com.vlath.keyboard.yml                             22-Feb-2021 12:18                1922
com.vlille.checker.yml                             22-Feb-2021 12:18                1842
com.vmihalachi.turboeditor.yml                     22-Feb-2021 12:18                 807
com.vocifery.daytripper.yml                        22-Feb-2021 12:18                1561
com.voidcode.diasporawebclient.yml                 22-Feb-2021 12:18                1361
com.volosyukivan.yml                               22-Feb-2021 12:18                1130
com.vonglasow.michael.qz.yml                       22-Feb-2021 12:18                1637
com.vonglasow.michael.satstat.yml                  22-Feb-2021 12:18                4410
com.vrem.wifianalyzer.yml                          22-Feb-2021 12:18                5470
com.vsmartcard.acardemulator.yml                   22-Feb-2021 12:18                2431
com.vsmartcard.remotesmartcardreader.app.yml       22-Feb-2021 12:18                2041
com.vuze.android.remote.yml                        22-Feb-2021 12:18                3674
com.vwp.locdemo.yml                                22-Feb-2021 12:18                 816
com.vwp.owmap.yml                                  22-Feb-2021 12:18                6670
com.vwp.owmini.yml                                 22-Feb-2021 12:18                4024
com.wabadaba.dziennik.yml                          22-Feb-2021 12:18                2249
com.waifusims.wanicchou.yml                        22-Feb-2021 12:18                1024
com.waist.line.yml                                 22-Feb-2021 12:18               10030
com.wanderfar.expander.yml                         22-Feb-2021 12:18                 929
com.wangdaye.mysplash.yml                          22-Feb-2021 12:18                8964
com.wanghaus.remembeer.yml                         22-Feb-2021 12:18                1036
com.watabou.pixeldungeon.yml                       22-Feb-2021 12:18                2165
com.wbrenna.gtfsoffline.yml                        22-Feb-2021 12:18                1429
com.weatherlight.elloshare.yml                     22-Feb-2021 12:18                3618
com.webworxshop.swallowcatcher.yml                 22-Feb-2021 12:18                 785
com.weicheng.taipeiyoubikeoffline.yml              22-Feb-2021 12:18                 664
com.wentam.defcol.yml                              22-Feb-2021 12:18                 671
com.wesaphzt.privatelocation.yml                   22-Feb-2021 12:18                 953
com.wesaphzt.privatelock.yml                       22-Feb-2021 12:18                 754
com.weskenyon.bookmarkos.yml                       22-Feb-2021 12:18                 643
com.wikaba.ogapp.yml                               22-Feb-2021 12:18                1418
com.wikijourney.wikijourney.yml                    22-Feb-2021 12:18                1424
com.willhauck.linconnectclient.yml                 22-Feb-2021 12:18                1122
com.willianveiga.countdowntimer.yml                22-Feb-2021 12:18                 839
com.wireguard.android.yml                          22-Feb-2021 12:18                9687
com.wmstein.tourcount.yml                          22-Feb-2021 12:18                6115
com.wmstein.transektcount.yml                      22-Feb-2021 12:18                6793
com.woefe.shoppinglist.yml                         22-Feb-2021 12:18                1292
com.wolas.awesomewallpaper.yml                     22-Feb-2021 12:18                 889
com.wordpress.chislonchow.legacylauncher.yml       22-Feb-2021 12:18                 733
com.wordpress.sarfraznawaz.callerdetails.yml       22-Feb-2021 12:18                 736
com.workingagenda.democracydroid.yml               22-Feb-2021 12:18                4849
com.workingagenda.devinettes.yml                   22-Feb-2021 12:18                1025
com.workingagenda.fissure.yml                      22-Feb-2021 12:18                1331
com.wownero.wownerujo.yml                          22-Feb-2021 12:18                4890
com.write.Quill.yml                                22-Feb-2021 12:18                2692
com.wrmndfzzy.atomize.yml                          22-Feb-2021 12:18                1016
com.x1unix.s60icons.yml                            22-Feb-2021 12:18                 874
com.xBrowserSync.android.yml                       22-Feb-2021 12:18                2526
com.xabber.android.classic.yml                     22-Feb-2021 12:18                2549
com.xabber.android.yml                             22-Feb-2021 12:18                4965
com.xabber.androiddev.yml                          22-Feb-2021 12:18               15789
com.xargsgrep.portknocker.yml                      22-Feb-2021 12:18                1124
com.xatik.app.droiddraw.client.yml                 22-Feb-2021 12:18                1551
com.xda.theme.cyanogenmod.yml                      22-Feb-2021 12:18                 494
com.xenris.liquidwarsos.yml                        22-Feb-2021 12:18                 843
com.xlythe.calculator.material.yml                 22-Feb-2021 12:18                1145
com.xlythe.minecraftclock.yml                      22-Feb-2021 12:18                 989
com.xmission.trevin.android.todo.yml               22-Feb-2021 12:18                 889
com.xperia64.timidityae.yml                        22-Feb-2021 12:18                1775
com.xvzan.simplemoneytracker.yml                   22-Feb-2021 12:18                 629
com.yacgroup.yacguide.dev.yml                      22-Feb-2021 12:18                1517
com.yacgroup.yacguide.yml                          22-Feb-2021 12:18                 531
com.yasfa.views.yml                                22-Feb-2021 12:18                 652
com.yassirh.digitalocean.yml                       22-Feb-2021 12:18                1434
com.ymber.eleven.yml                               22-Feb-2021 12:18                 963
com.yubico.yubiclip.yml                            22-Feb-2021 12:18                2113
com.yubico.yubioath.yml                            22-Feb-2021 12:18                3211
com.yubico.yubitotp.yml                            22-Feb-2021 12:18                1271
com.zachrattner.pockettalk.yml                     22-Feb-2021 12:18                 938
com.zagayevskiy.pacman.yml                         22-Feb-2021 12:18                 802
com.zapta.apps.maniana.yml                         22-Feb-2021 12:18                1120
com.zaren.yml                                      22-Feb-2021 12:18                2281
com.zeapo.pwdstore.yml                             22-Feb-2021 12:18               21645
com.zegoggles.gist.yml                             22-Feb-2021 12:18                 487
com.zegoggles.smssync.yml                          22-Feb-2021 12:18               10865
com.zell_mbc.medilog.yml                           22-Feb-2021 12:18                2549
com.zenstyle.muzei.wlppr.yml                       22-Feb-2021 12:18                 672
com.zeusln.zeus.yml                                22-Feb-2021 12:18                3781
com.zoffcc.applications.aagtl.yml                  22-Feb-2021 12:18                 838
com.zoffcc.applications.metalab_open_widget.yml    22-Feb-2021 12:18                 791
com.zoffcc.applications.trifa.yml                  22-Feb-2021 12:18               14493
com.zoffcc.applications.zanavi.yml                 22-Feb-2021 12:18               37604
com.zoffcc.fahrplan.toxcon.yml                     22-Feb-2021 12:18                 650
com.zola.bmi.yml                                   22-Feb-2021 12:18                1668
com.zorinos.zorin_connect.yml                      22-Feb-2021 12:18                1617
com.zzzmode.appopsx.yml                            22-Feb-2021 12:18                 594
community.fairphone.checkup.yml                    22-Feb-2021 12:18                 902
community.fairphone.clock.yml                      22-Feb-2021 12:18                 836
community.fairphone.fplauncher3.yml                22-Feb-2021 12:18                1006
community.fairphone.launcher.yml                   22-Feb-2021 12:18                 478
community.fairphone.mycontacts.yml                 22-Feb-2021 12:18                 911
community.peers.internetradio.yml                  22-Feb-2021 12:18                1703
community.peers.license.yml                        22-Feb-2021 12:18                 935
cos.premy.mines.yml                                22-Feb-2021 12:18                 806
covidsecure.uk.venuecheckin.yml                    22-Feb-2021 12:18                 560
cri.sanity.yml                                     22-Feb-2021 12:18                 559
cs4295.memecreator.yml                             22-Feb-2021 12:18                 663
csci567.squeez.yml                                 22-Feb-2021 12:18                 485
csd.qtproject.minesweeper.yml                      22-Feb-2021 12:18                 965
csh.cryptonite.yml                                 22-Feb-2021 12:18                1947
cx.hell.android.pdfview.yml                        22-Feb-2021 12:18                2477
cx.hell.android.pdfviewpro.yml                     22-Feb-2021 12:18                2074
cx.mccormick.pddroidparty.yml                      22-Feb-2021 12:18                2248
cx.ring.yml                                        22-Feb-2021 12:18               36326
cxa.gridwallpaper.yml                              22-Feb-2021 12:18                1120
cxa.lineswallpaper.yml                             22-Feb-2021 12:18                1183
cz.antecky.netswitch.yml                           22-Feb-2021 12:18                1131
cz.dvratil.fbeventsync.yml                         22-Feb-2021 12:18                2424
cz.eutopia.snooperstopper.yml                      22-Feb-2021 12:18                1473
cz.harvie.northdog.yml                             22-Feb-2021 12:18                 618
cz.hejl.chesswalk.yml                              22-Feb-2021 12:18                 839
cz.jiriskorpil.amixerwebui.yml                     22-Feb-2021 12:18                 795
cz.jirkovsky.lukas.chmupocasi.yml                  22-Feb-2021 12:18                 681
cz.martykan.forecastie.yml                         22-Feb-2021 12:18                6581
cz.martykan.webtube.yml                            22-Feb-2021 12:18                2051
cz.nic.turris.yml                                  22-Feb-2021 12:18                 868
cz.romario.opensudoku.yml                          22-Feb-2021 12:18                 971
cz.vitSkalicky.klavesnice.yml                      22-Feb-2021 12:18                1435
cz.vitskalicky.lepsirozvrh.yml                     22-Feb-2021 12:18                1636
cz.yetanotherview.webcamviewer.app.yml             22-Feb-2021 12:18                4751
d.d.meshenger.yml                                  22-Feb-2021 12:18                1022
damo.three.ie.yml                                  22-Feb-2021 12:18                1875
daniel_32.flexiblewallpaper.yml                    22-Feb-2021 12:18                1402
danielmeek32.compass.yml                           22-Feb-2021 12:18                 481
dasher.android.yml                                 22-Feb-2021 12:18                1268
de.Cherubin7th.blackscreenpresentationremote.yml   22-Feb-2021 12:18                1393
de.HS_Aalen.don.yml                                22-Feb-2021 12:18                 651
de.agrothe.go.yml                                  22-Feb-2021 12:18                 855
de.akaflieg_freiburg.enroute.yml                   22-Feb-2021 12:18                9124
de.antonarnold.android.xoverrideheadphonejackde..> 22-Feb-2021 12:18                1318
de.antonfluegge.android.yubnubwidgetadfree.yml     22-Feb-2021 12:18                1150
de.antonwolf.agendawidget.yml                      22-Feb-2021 12:18                 664
de.arnefeil.bewegungsmelder.yml                    22-Feb-2021 12:18                1110
de.arnowelzel.android.periodical.yml               22-Feb-2021 12:18                6071
de.asmw.sudokunst.yml                              22-Feb-2021 12:18                1149
de.audioattack.openlink.yml                        22-Feb-2021 12:18                3376
de.audioattack.yacy31c3search.yml                  22-Feb-2021 12:18                 804
de.audioattack.yacy32c3search.yml                  22-Feb-2021 12:18                1208
de.azapps.mirakel.dashclock.yml                    22-Feb-2021 12:18                1911
de.azapps.mirakelandroid.yml                       22-Feb-2021 12:18                5711
de.b0nk.fp1_epo_autoupdate.yml                     22-Feb-2021 12:18                2986
de.badaix.snapcast.yml                             22-Feb-2021 12:18                2593
de.bahnhoefe.deutschlands.bahnhofsfotos.yml        22-Feb-2021 12:18                1501
de.bashtian.dashclocksunrise.yml                   22-Feb-2021 12:18                1044
de.baswil.gctools.yml                              22-Feb-2021 12:18                 539
de.baumann.browser.yml                             22-Feb-2021 12:18               13488
de.baumann.diaspora.yml                            22-Feb-2021 12:18                2321
de.baumann.hhsmoodle.yml                           22-Feb-2021 12:18                4689
de.baumann.pdfcreator.yml                          22-Feb-2021 12:18                3620
de.baumann.quitsmoking.yml                         22-Feb-2021 12:18                2304
de.baumann.sieben.yml                              22-Feb-2021 12:18                3191
de.baumann.thema.yml                               22-Feb-2021 12:18                3302
de.baumann.weather.yml                             22-Feb-2021 12:18                4723
de.beatbrot.screenshotassistant.yml                22-Feb-2021 12:18                 695
de.benibela.videlibri.yml                          22-Feb-2021 12:18                2106
de.beowulf.wetter.yml                              22-Feb-2021 12:18                1181
de.binary_kitchen.doorlock_app.yml                 22-Feb-2021 12:18                1558
de.bitsharesmunich.smartcoinswallet.yml            22-Feb-2021 12:18                3631
de.bitsharesmunich.wallet.yml                      22-Feb-2021 12:18                4258
de.bjusystems.vdrmanager.yml                       22-Feb-2021 12:18                1518
de.blau.android.yml                                22-Feb-2021 12:18               28716
de.blinkt.openvpn.yml                              22-Feb-2021 12:18               11219
de.blocklink.pigrid.yml                            22-Feb-2021 12:18                1272
de.bloosberg.basti.childresuscalc.yml              22-Feb-2021 12:18                 562
de.boesling.hydromemo.yml                          22-Feb-2021 12:18                 933
de.bulling.barcodebuddyscanner.yml                 22-Feb-2021 12:18                 773
de.c3nav.droid.yml                                 22-Feb-2021 12:18                2325
de.ccc.events.badge.card10.yml                     22-Feb-2021 12:18                 835
de.chagemann.regexcrossword.yml                    22-Feb-2021 12:18                 840
de.chaosdorf.meteroid.yml                          22-Feb-2021 12:18                2131
de.christinecoenen.code.zapp.yml                   22-Feb-2021 12:18                5187
de.cketti.dashclock.k9.yml                         22-Feb-2021 12:18                1196
de.clemensbartz.android.launcher.yml               22-Feb-2021 12:18                2005
de.corona.tracing.yml                              22-Feb-2021 12:18                4020
de.cryptobitch.muelli.barcodegen.yml               22-Feb-2021 12:18                 867
de.cryptobitch.muelli.vouchercalc.yml              22-Feb-2021 12:18                1221
de.csicar.mensaplan.yml                            22-Feb-2021 12:18                1047
de.csicar.ning.yml                                 22-Feb-2021 12:18                 653
de.cwde.freeshisen.yml                             22-Feb-2021 12:18                1489
de.cweiske.headphoneindicator.yml                  22-Feb-2021 12:18                 958
de.cyberit.wasgeht.yml                             22-Feb-2021 12:18                 483
de.danielweisser.android.ldapsync.yml              22-Feb-2021 12:18                 664
de.danoeh.antennapod.yml                           22-Feb-2021 12:18               20318
de.delusions.measure.yml                           22-Feb-2021 12:18                1049
de.delusionsoftware.congress_fahrplan.yml          22-Feb-2021 12:18                 784
de.democracydeutschland.app.yml                    22-Feb-2021 12:18                6807
de.dennisguse.opentracks.yml                       22-Feb-2021 12:18                4372
de.determapp.android.yml                           22-Feb-2021 12:18                 725
de.devisnik.android.sliding.yml                    22-Feb-2021 12:18                 545
de.devmil.muzei.bingimageofthedayartsource.yml     22-Feb-2021 12:18                1181
de.devmil.paperlaunch.yml                          22-Feb-2021 12:18                1409
de.digisocken.anotherrss.yml                       22-Feb-2021 12:18                3905
de.digisocken.openwort.yml                         22-Feb-2021 12:18                1698
de.digisocken.reotwe.yml                           22-Feb-2021 12:18                1701
de.digisocken.stop_o_moto.yml                      22-Feb-2021 12:18                 730
de.dotwee.micropinner.yml                          22-Feb-2021 12:18                1790
de.drhoffmannsoft.pizza.yml                        22-Feb-2021 12:18                1063
de.drhoffmannsoftware.calcvac.yml                  22-Feb-2021 12:18                1372
de.drhoffmannsoftware.xearth.yml                   22-Feb-2021 12:18                 873
de.drhoffmannsoftware.yml                          22-Feb-2021 12:18                 981
de.duenndns.gmdice.yml                             22-Feb-2021 12:18                 985
de.eidottermihi.raspicheck.yml                     22-Feb-2021 12:18                1493
de.eknoes.inofficialgolem.yml                      22-Feb-2021 12:18                 537
de.enaikoon.android.keypadmapper3.yml              22-Feb-2021 12:18                1305
de.feisar.wordvalue.yml                            22-Feb-2021 12:18                 728
de.fff.ccgt.yml                                    22-Feb-2021 12:18                 721
de.fgerbig.spacepeng.yml                           22-Feb-2021 12:18                 688
de.fmaul.android.cmis.yml                          22-Feb-2021 12:18                 669
de.fragdenstaat.app.yml                            22-Feb-2021 12:18                6921
de.freehamburger.yml                               22-Feb-2021 12:18                 583
de.freewarepoint.whohasmystuff.yml                 22-Feb-2021 12:18                3614
de.freifunk_karte.freifunk_karte.yml               22-Feb-2021 12:18                1083
de.fzi.bettyrieckmann.quotingstars.yml             22-Feb-2021 12:18                 440
de.gabbo.forro_lyrics.yml                          22-Feb-2021 12:18                2403
de.geeksfactory.opacclient.yml                     22-Feb-2021 12:18               81469
de.grobox.appbundlereporter.yml                    22-Feb-2021 12:18                 516
de.grobox.blitzmail.yml                            22-Feb-2021 12:18                5986
de.grobox.liberario.yml                            22-Feb-2021 12:18                8387
de.guerda.matekarte.yml                            22-Feb-2021 12:18                1618
de.hampager.dapnetmobile.yml                       22-Feb-2021 12:18                2264
de.hauke_stieler.geonotes.yml                      22-Feb-2021 12:18                 984
de.hechler.andfish.yml                             22-Feb-2021 12:18                 655
de.hfu.funfpunktnull.yml                           22-Feb-2021 12:18                1677
de.hirtenstrasse.michael.lnkshortener.yml          22-Feb-2021 12:18                1806
de.hoffmannsgimmicks.yml                           22-Feb-2021 12:18                1167
de.hoffmannsgimmickstaupunkt.yml                   22-Feb-2021 12:18                1601
de.homac.Mirrored.yml                              22-Feb-2021 12:18                1325
de.hosenhasser.funktrainer.yml                     22-Feb-2021 12:18                1175
de.hskl.contacts.yml                               22-Feb-2021 12:18                1511
de.hu_berlin.eduroam.yml                           22-Feb-2021 12:18                1075
de.hu_berlin.informatik.spws2014.mapever.yml       22-Feb-2021 12:18                1113
de.igloffstein.maik.aRevelation.yml                22-Feb-2021 12:18                1293
de.j4velin.pedometer.yml                           22-Feb-2021 12:18                3160
de.j4velin.systemappmover.yml                      22-Feb-2021 12:18                3486
de.j4velin.wifiAutoOff.yml                         22-Feb-2021 12:18                9211
de.jbservices.nc_passwords_app.yml                 22-Feb-2021 12:18                2702
de.jdsoft.law.yml                                  22-Feb-2021 12:18                2904
de.jkliemann.parkendd.yml                          22-Feb-2021 12:18                4432
de.jl.notificationlog.yml                          22-Feb-2021 12:18                2252
de.joergjahnke.c64.android.yml                     22-Feb-2021 12:18                 440
de.jonasbernard.tudarmstadtmoodlewrapper.yml       22-Feb-2021 12:18                 653
de.jugendhacker.xmppadmin.yml                      22-Feb-2021 12:18                 869
de.jurihock.voicesmith.yml                         22-Feb-2021 12:18                2070
de.k3b.android.androFotoFinder.yml                 22-Feb-2021 12:18                6027
de.k3b.android.calendar.ics.adapter.yml            22-Feb-2021 12:18                2288
de.k3b.android.contentproviderhelper.yml           22-Feb-2021 12:18                1625
de.k3b.android.intentintercept.yml                 22-Feb-2021 12:18                1179
de.k3b.android.locationMapViewer.yml               22-Feb-2021 12:18                2259
de.k3b.android.lossless_jpg_crop.yml               22-Feb-2021 12:18                1366
de.k3b.android.toGoZip.yml                         22-Feb-2021 12:18                2836
de.k4ever.k4android.yml                            22-Feb-2021 12:18                 892
de.kaffeemitkoffein.feinstaubwidget.yml            22-Feb-2021 12:18                 736
de.kaffeemitkoffein.imagepipe.yml                  22-Feb-2021 12:18                1331
de.kaffeemitkoffein.tinyweatherforecastgermany.yml 22-Feb-2021 12:18                1319
de.karbach.tac.yml                                 22-Feb-2021 12:18                1783
de.kodejak.hashr.yml                               22-Feb-2021 12:18                1094
de.koelle.christian.trickytripper.yml              22-Feb-2021 12:18                3015
de.kromke.andreas.mediascanner.yml                 22-Feb-2021 12:18                1733
de.kromke.andreas.musictagger.yml                  22-Feb-2021 12:18                2111
de.kromke.andreas.opus1musicplayer.yml             22-Feb-2021 12:18                 624
de.kromke.andreas.unpopmusicplayerfree.yml         22-Feb-2021 12:18                4737
de.kromonos.android.rpcoiner.yml                   22-Feb-2021 12:18                 492
de.ktran.anno1404warenrechner.yml                  22-Feb-2021 12:18                 826
de.kugihan.dictionaryformids.hmi_android.yml       22-Feb-2021 12:18                2185
de.langerhans.wallet.yml                           22-Feb-2021 12:18                2450
de.larcado.sesam.yml                               22-Feb-2021 12:18                 794
de.laxu.apps.nachtlagerdownloader.yml              22-Feb-2021 12:18                 505
de.leowandersleb.bitcoinsw.yml                     22-Feb-2021 12:18                 561
de.lihotzki.pixelflood.yml                         22-Feb-2021 12:18                1415
de.lisas.alex.runuserinit.yml                      22-Feb-2021 12:18                 873
de.live.gdev.cherrymusic.yml                       22-Feb-2021 12:18                2393
de.live.gdev.timetracker.yml                       22-Feb-2021 12:18                3397
de.locked.cellmapper.yml                           22-Feb-2021 12:18                 911
de.lsubel.amam.yml                                 22-Feb-2021 12:18                1722
de.luhmer.owncloudnewsreader.yml                   22-Feb-2021 12:18               57003
de.mangelow.balance.yml                            22-Feb-2021 12:18                 767
de.mangelow.debdroid.yml                           22-Feb-2021 12:18                 948
de.mangelow.network.yml                            22-Feb-2021 12:18                 908
de.mangelow.slideitloud.yml                        22-Feb-2021 12:18                 798
de.mangelow.syncwifi.yml                           22-Feb-2021 12:18                 726
de.mangelow.throughput.yml                         22-Feb-2021 12:18                1143
de.markusfisch.android.binaryeye.yml               22-Feb-2021 12:18                7995
de.markusfisch.android.shadereditor.yml            22-Feb-2021 12:18                5203
de.markusfisch.android.wavelines.yml               22-Feb-2021 12:18                2640
de.marmaro.krt.ffupdater.yml                       22-Feb-2021 12:18                5896
de.mbutscher.wikiandpad.alphabeta.yml              22-Feb-2021 12:18                1403
de.measite.contactmerger.yml                       22-Feb-2021 12:18                1395
de.meonwax.soundboard.yml                          22-Feb-2021 12:18                1188
de.metager.metagerapp.fdroid.yml                   22-Feb-2021 12:18                 635
de.micmun.android.deufeitage.yml                   22-Feb-2021 12:18                1301
de.micmun.android.nextcloudcookbook.yml            22-Feb-2021 12:18                 848
de.moekadu.metronome.yml                           22-Feb-2021 12:18                1893
de.moooon.acrylicons.yml                           22-Feb-2021 12:18                1268
de.moroway.oc.yml                                  22-Feb-2021 12:18                1624
de.mpg.mpdl.labcam.yml                             22-Feb-2021 12:18                1042
de.mreiter.countit.yml                             22-Feb-2021 12:18                 581
de.msal.muzei.nationalgeographic.yml               22-Feb-2021 12:18                1808
de.mw136.tonuino.yml                               22-Feb-2021 12:18                1402
de.mwvb.blockpuzzle.yml                            22-Feb-2021 12:18                1127
de.naturalnet.mirwtfapp.yml                        22-Feb-2021 12:18                1476
de.naturalnet.zahnarztgeraeusche.yml               22-Feb-2021 12:18                 824
de.nellessen.usercontrolleddecryptionoperations..> 22-Feb-2021 12:18                1458
de.nico.asura.yml                                  22-Feb-2021 12:18                1629
de.nico.gpt.yml                                    22-Feb-2021 12:18                 976
de.nico.ha_manager.yml                             22-Feb-2021 12:18                2331
de.nodomain.tobihille.seniorlauncher.yml           22-Feb-2021 12:18                2135
de.nproth.pin.yml                                  22-Feb-2021 12:18                1328
de.nulide.bikecomputer.yml                         22-Feb-2021 12:18                 849
de.nulide.findmydevice.yml                         22-Feb-2021 12:18                1108
de.nulide.shiftcal.yml                             22-Feb-2021 12:18                1154
de.onyxbits.droidentify.yml                        22-Feb-2021 12:18                 804
de.onyxbits.drudgery.yml                           22-Feb-2021 12:18                1332
de.onyxbits.geobookmark.yml                        22-Feb-2021 12:18                1669
de.onyxbits.listmyapps.yml                         22-Feb-2021 12:18                2923
de.onyxbits.photobookmark.yml                      22-Feb-2021 12:18                 722
de.onyxbits.pocketbandit.yml                       22-Feb-2021 12:18                1203
de.onyxbits.remotekeyboard.yml                     22-Feb-2021 12:18                2067
de.onyxbits.sensorreadout.yml                      22-Feb-2021 12:18                1665
de.onyxbits.textfiction.yml                        22-Feb-2021 12:18                1779
de.perflyst.batterycalibration.yml                 22-Feb-2021 12:18                1032
de.perflyst.untis.yml                              22-Feb-2021 12:18                1968
de.ph1b.audiobook.yml                              22-Feb-2021 12:18               20013
de.phoenixstudios.pc_dimmer.yml                    22-Feb-2021 12:18                1073
de.php_tech.piggybudget.yml                        22-Feb-2021 12:18                6266
de.pinyto.exalteddicer.yml                         22-Feb-2021 12:18                1171
de.piratentools.spickerrr.yml                      22-Feb-2021 12:18                 731
de.pixart.messenger.yml                            22-Feb-2021 12:18                4267
de.qspool.clementineremote.yml                     22-Feb-2021 12:18                3524
de.quaddyservices.dynamicnightlight.yml            22-Feb-2021 12:18                2017
de.r4md4c.gamedealz.yml                            22-Feb-2021 12:18                4099
de.rampro.activitydiary.yml                        22-Feb-2021 12:18                2189
de.reimardoeffinger.quickdic.yml                   22-Feb-2021 12:18                5768
de.repat.mosf.yml                                  22-Feb-2021 12:18                 680
de.retujo.bierverkostung.yml                       22-Feb-2021 12:18                1397
de.robv.android.xposed.installer.yml               22-Feb-2021 12:18                1349
de.rochefort.childmonitor.yml                      22-Feb-2021 12:18                 505
de.rwth_aachen.phyphox.yml                         22-Feb-2021 12:18                3384
de.salomax.currencies.yml                          22-Feb-2021 12:18                 696
de.saschahlusiak.freebloks.yml                     22-Feb-2021 12:18                2669
de.schaeuffelhut.android.openvpn.yml               22-Feb-2021 12:18                1208
de.schildbach.oeffi.yml                            22-Feb-2021 12:18               12082
de.schildbach.wallet.faircoin.yml                  22-Feb-2021 12:18                 870
de.schildbach.wallet.yml                           22-Feb-2021 12:18               50456
de.schildbach.wallet_test.yml                      22-Feb-2021 12:18               49512
de.schlikk.calls.yml                               22-Feb-2021 12:18                 457
de.selfnet.wifisetup.yml                           22-Feb-2021 12:18                 630
de.sensebox.blockly.yml                            22-Feb-2021 12:18                1565
de.serverfrog.pw.android.yml                       22-Feb-2021 12:18                1260
de.shandschuh.slightbackup.yml                     22-Feb-2021 12:18                1412
de.shandschuh.sparserss.yml                        22-Feb-2021 12:18                1233
de.sigfood.yml                                     22-Feb-2021 12:18                 960
de.simplestatswidget.yml                           22-Feb-2021 12:18                1242
de.skubware.opentraining.yml                       22-Feb-2021 12:18                4390
de.smasi.tickmate.yml                              22-Feb-2021 12:18                3634
de.spiritcroc.darkcroc.substratum.yml              22-Feb-2021 12:18                2710
de.spiritcroc.defaultdarktheme_oms.yml             22-Feb-2021 12:18                2278
de.spiritcroc.riotx.yml                            22-Feb-2021 12:18               10636
de.srlabs.gsmmap.yml                               22-Feb-2021 12:18                1136
de.srlabs.snoopsnitch.yml                          22-Feb-2021 12:18               10318
de.stefan_oltmann.falling_blocks.yml               22-Feb-2021 12:18                 486
de.stefan_oltmann.kaesekaestchen.yml               22-Feb-2021 12:18                 836
de.steinpfeffer.rdt.yml                            22-Feb-2021 12:18                 464
de.stephanlindauer.criticalmaps.yml                22-Feb-2021 12:18                8200
de.storchp.fdroidbuildstatus.yml                   22-Feb-2021 12:18                1347
de.storchp.opentracks.osmplugin.offline.yml        22-Feb-2021 12:18                 908
de.storchp.opentracks.osmplugin.yml                22-Feb-2021 12:18                2283
de.sudoq.yml                                       22-Feb-2021 12:18                2288
de.syss.MifareClassicTool.yml                      22-Feb-2021 12:18                6883
de.szalkowski.activitylauncher.yml                 22-Feb-2021 12:18                1521
de.t_dankworth.secscanqr.yml                       22-Feb-2021 12:18                3232
de.tadris.fitness.yml                              22-Feb-2021 12:18                2784
de.tap.easy_xkcd.yml                               22-Feb-2021 12:18               41081
de.taz.android.app.free.yml                        22-Feb-2021 12:18                 783
de.tcrass.minos.yml                                22-Feb-2021 12:18                 563
de.thecode.android.tazreader.yml                   22-Feb-2021 12:18                4241
de.thecode.lmd.yml                                 22-Feb-2021 12:18                1973
de.tobiasbielefeld.brickgames.yml                  22-Feb-2021 12:18                1931
de.tobiasbielefeld.searchbar.yml                   22-Feb-2021 12:18                1251
de.tobiasbielefeld.solitaire.yml                   22-Feb-2021 12:18                5355
de.toshsoft.tsvnc.yml                              22-Feb-2021 12:18                 539
de.tu_chemnitz.wlan.yml                            22-Feb-2021 12:18                1612
de.tui.itlogger.yml                                22-Feb-2021 12:18                1121
de.tum.in.tumcampus.yml                            22-Feb-2021 12:18                2208
de.tutao.tutanota.yml                              22-Feb-2021 12:18               32653
de.ub0r.android.callmeter.yml                      22-Feb-2021 12:18                3454
de.ub0r.android.clipboardbeam.yml                  22-Feb-2021 12:18                 816
de.ub0r.android.portaltimer.yml                    22-Feb-2021 12:18                 788
de.ub0r.android.smsdroid.yml                       22-Feb-2021 12:18                4531
de.ub0r.android.websms.connector.gmx.yml           22-Feb-2021 12:18                 722
de.ub0r.android.websms.connector.smspilotru.yml    22-Feb-2021 12:18                 873
de.ub0r.android.websms.yml                         22-Feb-2021 12:18                4716
de.uni_potsdam.hpi.openmensa.yml                   22-Feb-2021 12:18                2667
de.uwepost.android.deltacam.yml                    22-Feb-2021 12:18                1199
de.vanitasvitae.enigmandroid.yml                   22-Feb-2021 12:18                2416
de.vibora.viborafeed.yml                           22-Feb-2021 12:18                4111
de.vier_bier.habpanelviewer.yml                    22-Feb-2021 12:18                1353
de.we.acaldav.yml                                  22-Feb-2021 12:18                1653
de.wellenvogel.bonjourbrowser.yml                  22-Feb-2021 12:18                 583
de.westnordost.streetcomplete.yml                  22-Feb-2021 12:18               13058
de.wikilab.android.friendica01.yml                 22-Feb-2021 12:18                1542
de.wikilab.android.ldapsync.yml                    22-Feb-2021 12:18                1031
de.xskat.yml                                       22-Feb-2021 12:18                 955
de.yaacc.yml                                       22-Feb-2021 12:18                2621
de.yazo_games.mensaguthaben.yml                    22-Feb-2021 12:18                1023
de.zauberstuhl.sechat.yml                          22-Feb-2021 12:18                1313
de.zieren.rot13.yml                                22-Feb-2021 12:18                 814
deep.ryd.rydplayer.yml                             22-Feb-2021 12:18                7355
dentex.youtube.downloader.yml                      22-Feb-2021 12:18                5222
design.codeux.authpass.fdroid.yml                  22-Feb-2021 12:18               11925
dev.corruptedark.openchaoschess.yml                22-Feb-2021 12:18                2044
dev.drsoran.moloko.yml                             22-Feb-2021 12:18                2382
dev.dworks.apps.anexplorer.pro.yml                 22-Feb-2021 12:18                2132
dev.jmoore.lametricnotify.yml                      22-Feb-2021 12:18                 646
dev.jtsalva.cloudmare.yml                          22-Feb-2021 12:18                1082
dev.leonlatsch.photok.yml                          22-Feb-2021 12:18                1035
dev.lonami.klooni.yml                              22-Feb-2021 12:18                 784
dev.lucanlm.antimine.yml                           22-Feb-2021 12:18                9577
dev.marchello.sharik.yml                           22-Feb-2021 12:18                1029
dev.msfjarvis.aps.yml                              22-Feb-2021 12:18                3331
dev.patrickgold.florisboard.yml                    22-Feb-2021 12:18                1134
dev.pesic.rpncalc.yml                              22-Feb-2021 12:18                1548
dev.ukanth.ufirewall.yml                           22-Feb-2021 12:18               23538
dk.andsen.asqlitemanager.yml                       22-Feb-2021 12:18                1785
dk.jens.backup.yml                                 22-Feb-2021 12:18                6709
dk.kjeldsen.carwingsflutter.yml                    22-Feb-2021 12:18               19242
dk.kk.ibikecph.yml                                 22-Feb-2021 12:18                1912
dk.meznik.jan.encrypttext.yml                      22-Feb-2021 12:18                 884
dk.mide.fas.cmnightlies.yml                        22-Feb-2021 12:18                 969
dk.nindroid.rss.yml                                22-Feb-2021 12:18                 793
dmusiolik.pijaret.yml                              22-Feb-2021 12:18                1491
dnsfilter.android.yml                              22-Feb-2021 12:18                3725
douzifly.list.yml                                  22-Feb-2021 12:18                2214
dudeofx.eval.yml                                   22-Feb-2021 12:18                 956
dulleh.akhyou.fdroid.yml                           22-Feb-2021 12:18                 891
dummydomain.yetanothercallblocker.yml              22-Feb-2021 12:18                3149
edu.berkeley.boinc.yml                             22-Feb-2021 12:18                1865
edu.cmu.cs.speech.tts.flite.yml                    22-Feb-2021 12:18                1529
edu.cmu.cylab.starslinger.demo.yml                 22-Feb-2021 12:18                1660
edu.cmu.cylab.starslinger.yml                      22-Feb-2021 12:18                1912
edu.cmu.pocketsphinx.demo.yml                      22-Feb-2021 12:18                1444
edu.harvard.android.mmskeeper.yml                  22-Feb-2021 12:18                1281
edu.killerud.kitchentimer.yml                      22-Feb-2021 12:18                1056
edu.nyu.cs.omnidroid.app.yml                       22-Feb-2021 12:18                 947
edu.rit.poe.atomix.yml                             22-Feb-2021 12:18                 657
edu.sfsu.cs.orange.ocr.yml                         22-Feb-2021 12:18                2169
edu.stanford.rkpandey.covid19tracker.yml           22-Feb-2021 12:18                 625
ee.ioc.phon.android.speak.yml                      22-Feb-2021 12:18                4756
ee.smkv.calc.loan.yml                              22-Feb-2021 12:18                 942
email.schaal.ocreader.yml                          22-Feb-2021 12:18                6234
errorc2146.whereaminext.yml                        22-Feb-2021 12:18                 716
es.cesar.quitesleep.yml                            22-Feb-2021 12:18                1529
es.eoinrul.ecwt.yml                                22-Feb-2021 12:18                 773
es.esy.CosyDVR.yml                                 22-Feb-2021 12:18                3306
es.prodevelop.gvsig.mini.yml                       22-Feb-2021 12:18                 644
es.usc.citius.servando.calendula.yml               22-Feb-2021 12:18               10048
espero.jiofibatterynotifier.yml                    22-Feb-2021 12:18                 844
et.nWifiManager.yml                                22-Feb-2021 12:18                1081
eth.matteljay.mastermindy.yml                      22-Feb-2021 12:18                 557
eu.bauerj.paperless_app.yml                        22-Feb-2021 12:18                2954
eu.bubu1.fdroidclassic.yml                         22-Feb-2021 12:18                 784
eu.depau.etchdroid.yml                             22-Feb-2021 12:18                2579
eu.devunit.fb_client.yml                           22-Feb-2021 12:18                 916
eu.domob.anacam.yml                                22-Feb-2021 12:18                1294
eu.domob.angulo.yml                                22-Feb-2021 12:18                1414
eu.domob.bjtrainer.yml                             22-Feb-2021 12:18                 875
eu.domob.shopt.yml                                 22-Feb-2021 12:18                 859
eu.dorfbrunnen.momkin.yml                          22-Feb-2021 12:18                 547
eu.droogers.smsmatrix.yml                          22-Feb-2021 12:18                2244
eu.e43.impeller.yml                                22-Feb-2021 12:18                7974
eu.faircode.email.yml                              22-Feb-2021 12:18               75665
eu.faircode.finegeotag.yml                         22-Feb-2021 12:18                1377
eu.faircode.netguard.yml                           22-Feb-2021 12:18               32441
eu.faircode.xlua.yml                               22-Feb-2021 12:18                5603
eu.flatworld.android.slider.yml                    22-Feb-2021 12:18                1358
eu.halaser.beamctrl.yml                            22-Feb-2021 12:18                1540
eu.hydrologis.geopaparazzi.yml                     22-Feb-2021 12:18                3007
eu.inmite.android.gridwichterle.yml                22-Feb-2021 12:18                 665
eu.johncasson.meerkatchallenge.yml                 22-Feb-2021 12:18                 495
eu.kanade.tachiyomi.yml                            22-Feb-2021 12:18                8834
eu.lavarde.pmtd.yml                                22-Feb-2021 12:18                3589
eu.lepiller.nani.yml                               22-Feb-2021 12:18                1341
eu.lighthouselabs.obd.reader.yml                   22-Feb-2021 12:18                 921
eu.mrogalski.saidit.yml                            22-Feb-2021 12:18                1743
eu.polarclock.yml                                  22-Feb-2021 12:18                1442
eu.pretix.pretixdroid.yml                          22-Feb-2021 12:18                1524
eu.pretix.pretixprint.yml                          22-Feb-2021 12:18                2103
eu.pretix.pretixscan.droid.yml                     22-Feb-2021 12:18                3872
eu.prismsw.lampshade.yml                           22-Feb-2021 12:18                1268
eu.quelltext.coloring.yml                          22-Feb-2021 12:18                2132
eu.quelltext.gita.yml                              22-Feb-2021 12:18                 515
eu.quelltext.memory.yml                            22-Feb-2021 12:18                 789
eu.quelltext.mundraub.yml                          22-Feb-2021 12:18                7340
eu.roggstar.getmitokens.yml                        22-Feb-2021 12:18                 767
eu.roggstar.luigithehunter.batterycalibrate.yml    22-Feb-2021 12:18                 756
eu.roggstar.luigithehunter.dsaassistent.yml        22-Feb-2021 12:18                1129
eu.ryuu.screeps.yml                                22-Feb-2021 12:18                1029
eu.siacs.conversations.legacy.yml                  22-Feb-2021 12:18                1929
eu.siacs.conversations.voicerecorder.yml           22-Feb-2021 12:18                1252
eu.siacs.conversations.yml                         22-Feb-2021 12:18               55424
eu.siebeck.sipswitch.yml                           22-Feb-2021 12:18                1316
eu.sum7.conversations.yml                          22-Feb-2021 12:18               18537
eu.uwot.fabio.altcoinprices.yml                    22-Feb-2021 12:18                6659
eu.veldsoft.brainstonz.yml                         22-Feb-2021 12:18                2387
eu.veldsoft.colors.overflow.yml                    22-Feb-2021 12:18                1846
eu.veldsoft.complica4.yml                          22-Feb-2021 12:18                1398
eu.veldsoft.dice.overflow.yml                      22-Feb-2021 12:18                 988
eu.veldsoft.fish.rings.yml                         22-Feb-2021 12:18                 893
eu.veldsoft.four.row.solitaire.yml                 22-Feb-2021 12:18                1665
eu.veldsoft.free.klondike.yml                      22-Feb-2021 12:18                1517
eu.veldsoft.house.of.cards.yml                     22-Feb-2021 12:18                2179
eu.veldsoft.hungarian.rings.yml                    22-Feb-2021 12:18                1212
eu.veldsoft.ithaka.board.game.yml                  22-Feb-2021 12:18                1618
eu.veldsoft.kechi.yml                              22-Feb-2021 12:18                 918
eu.veldsoft.politrics.yml                          22-Feb-2021 12:18                1337
eu.veldsoft.scribe4.yml                            22-Feb-2021 12:18                1309
eu.veldsoft.svarka.odds.calculator.yml             22-Feb-2021 12:18                1014
eu.veldsoft.tri.peaks.yml                          22-Feb-2021 12:18                 835
eu.veldsoft.tuty.fruty.slot.yml                    22-Feb-2021 12:18                 699
eu.veldsoft.vitosha.blackjack.yml                  22-Feb-2021 12:18                 778
eu.veldsoft.vitosha.poker.odds.yml                 22-Feb-2021 12:18                1323
eu.veldsoft.vitoshadm.yml                          22-Feb-2021 12:18                 839
eu.vranckaert.worktime.yml                         22-Feb-2021 12:18                1493
eu.wikijourney.wikijourney.yml                     22-Feb-2021 12:18                1613
eu.woju.android.packages.hud.yml                   22-Feb-2021 12:18                1010
eun.initialvolume.yml                              22-Feb-2021 12:18                 542
exa.lnx.a.yml                                      22-Feb-2021 12:18                4039
faenza.adw.theme.yml                               22-Feb-2021 12:18                 386
felixwiemuth.lincal.yml                            22-Feb-2021 12:18                1539
felixwiemuth.simplereminder.yml                    22-Feb-2021 12:18                 659
fi.bitrite.android.ws.yml                          22-Feb-2021 12:18                2100
fi.harism.wallpaper.flier.yml                      22-Feb-2021 12:18                 602
fi.harism.wallpaper.flowers.yml                    22-Feb-2021 12:18                 441
fi.harism.wallpaper.yinyang.yml                    22-Feb-2021 12:18                 472
fi.kroon.vadret.yml                                22-Feb-2021 12:18                5154
fi.mikuz.boarder.yml                               22-Feb-2021 12:18                1339
fi.testbed2.yml                                    22-Feb-2021 12:18                1506
fil.libre.repwifiapp.yml                           22-Feb-2021 12:18                 933
fluddokt.opsu.android.yml                          22-Feb-2021 12:18                 499
flunzmas.seasoncalendar.yml                        22-Feb-2021 12:18                1895
fly.speedmeter.grub.yml                            22-Feb-2021 12:18                1184
fm.a2d.sf.yml                                      22-Feb-2021 12:18                3598
fm.libre.droid.yml                                 22-Feb-2021 12:18                 996
foehnix.widget.yml                                 22-Feb-2021 12:18                1652
foss.cnugteren.nlweer.yml                          22-Feb-2021 12:18                1461
foundation.e.blisslauncher.yml                     22-Feb-2021 12:18                1650
fr.ac_versailles.dane.xiaexpress.yml               22-Feb-2021 12:18                1484
fr.asterope.yml                                    22-Feb-2021 12:18                 720
fr.bellev.stdatmosphere.yml                        22-Feb-2021 12:18                 817
fr.bepo.clavierexterne.yml                         22-Feb-2021 12:18                1572
fr.byped.bwarearea.yml                             22-Feb-2021 12:18                1362
fr.cap_rel.fr.sagc_plongee.fr.nitroxCalc.yml       22-Feb-2021 12:18                 929
fr.chenry.android.freshrss.yml                     22-Feb-2021 12:18                1869
fr.corenting.convertisseureurofranc.yml            22-Feb-2021 12:18                 904
fr.corenting.traficparis.yml                       22-Feb-2021 12:18                1077
fr.covidat.android.yml                             22-Feb-2021 12:18                1347
fr.cph.chicago.foss.yml                            22-Feb-2021 12:18               22327
fr.free.nrw.commons.yml                            22-Feb-2021 12:18                6339
fr.gaulupeau.apps.InThePoche.yml                   22-Feb-2021 12:18                4163
fr.gaulupeau.apps.Poche.yml                        22-Feb-2021 12:18                 764
fr.gouv.android.stopcovid.yml                      22-Feb-2021 12:18                2616
fr.gouv.etalab.mastodon.yml                        22-Feb-2021 12:18               50012
fr.guillaumevillena.opendnsupdater.yml             22-Feb-2021 12:18                1086
fr.herverenault.directdictaphone.yml               22-Feb-2021 12:18                1822
fr.herverenault.selfhostedgpstracker.yml           22-Feb-2021 12:18                1492
fr.hnit.babyname.yml                               22-Feb-2021 12:18                 686
fr.hnit.riverferry.yml                             22-Feb-2021 12:18                 729
fr.jakse.raphael.simpleprotocolplayer.yml          22-Feb-2021 12:18                 676
fr.jnda.android.flashalert.yml                     22-Feb-2021 12:18                1033
fr.jnda.android.ipcalc.yml                         22-Feb-2021 12:18                 731
fr.keuse.rightsalert.yml                           22-Feb-2021 12:18                 778
fr.kwiatkowski.ApkTrack.yml                        22-Feb-2021 12:18                3474
fr.librinfo.evecontrol2.yml                        22-Feb-2021 12:18                1137
fr.ludo1520.whatexp.yml                            22-Feb-2021 12:18                 878
fr.magistry.taigime.yml                            22-Feb-2021 12:18                 700
fr.masciulli.drinks.yml                            22-Feb-2021 12:18                2214
fr.miximum.napply.yml                              22-Feb-2021 12:18                 998
fr.mobdev.blooddonation.yml                        22-Feb-2021 12:18                1447
fr.mobdev.goblim.yml                               22-Feb-2021 12:18                2136
fr.neamar.kiss.yml                                 22-Feb-2021 12:18               13988
fr.nicopico.dashclock.birthday.yml                 22-Feb-2021 12:18                 840
fr.nihilus.music.yml                               22-Feb-2021 12:18                 626
fr.nocle.passegares.yml                            22-Feb-2021 12:18                4234
fr.nuage.souvenirs.yml                             22-Feb-2021 12:18                 733
fr.ornidroid.yml                                   22-Feb-2021 12:18                 837
fr.pssoftware.scoretarot.yml                       22-Feb-2021 12:18                1711
fr.ralala.hexviewer.yml                            22-Feb-2021 12:18                 607
fr.renzo.wikipoff.yml                              22-Feb-2021 12:18                1755
fr.rhaz.ipfs.sweet.yml                             22-Feb-2021 12:18                1568
fr.s13d.photobackup.yml                            22-Feb-2021 12:18                2472
fr.s3i.pointeuse.yml                               22-Feb-2021 12:18                 528
fr.seeks.yml                                       22-Feb-2021 12:18                 517
fr.simon.marquis.preferencesmanager.yml            22-Feb-2021 12:18                3286
fr.simon.marquis.secretcodes.yml                   22-Feb-2021 12:18                1524
fr.smarquis.sleeptimer.yml                         22-Feb-2021 12:18                 630
fr.strasweb.asso.yml                               22-Feb-2021 12:18                 621
fr.strasweb.browserquest.yml                       22-Feb-2021 12:18                1189
fr.strasweb.campus.yml                             22-Feb-2021 12:18                 520
fr.syncarnet.yml                                   22-Feb-2021 12:18                 559
fr.tvbarthel.apps.cameracolorpicker.yml            22-Feb-2021 12:18                 745
fr.tvbarthel.apps.simplethermometer.yml            22-Feb-2021 12:18                 870
fr.tvbarthel.apps.simpleweatherforcast.yml         22-Feb-2021 12:18                1420
fr.tvbarthel.attempt.googlyzooapp.yml              22-Feb-2021 12:18                1052
fr.twentynine.keepon.yml                           22-Feb-2021 12:18                 562
fr.ubordeaux.math.paridroid.yml                    22-Feb-2021 12:18                3951
fr.unix_experience.owncloud_sms.yml                22-Feb-2021 12:18               11552
fr.witchdoctors.c4ffein.oosfirmwareextractor.yml   22-Feb-2021 12:18                1146
fr.xgouchet.packageexplorer.yml                    22-Feb-2021 12:18                1411
fr.xgouchet.texteditor.yml                         22-Feb-2021 12:18                1385
fr.xplod.focal.yml                                 22-Feb-2021 12:18                2981
fr.xtof54.dragonGoApp.yml                          22-Feb-2021 12:18                1537
fr.xtof54.mousetodon.yml                           22-Feb-2021 12:18                1118
fr.xtof54.scrabble.yml                             22-Feb-2021 12:18                 651
fr.ybo.transportsbordeaux.yml                      22-Feb-2021 12:18               13946
fr.ybo.transportsrennes.yml                        22-Feb-2021 12:18               16970
free.rm.netcfgwidget.yml                           22-Feb-2021 12:18                 675
free.rm.skytube.oss.yml                            22-Feb-2021 12:18                5996
free.yhc.feeder.yml                                22-Feb-2021 12:18                 741
free.yhc.netmbuddy.yml                             22-Feb-2021 12:18                1524
freemap.opentrail.yml                              22-Feb-2021 12:18                2987
friimaind.piholedroid.yml                          22-Feb-2021 12:18                2458
ga.chschtsch.milonhapashut.yml                     22-Feb-2021 12:18                 630
ga.testapp.testapp.yml                             22-Feb-2021 12:18                4607
genius.mohammad.floating.stickies.yml              22-Feb-2021 12:18                 690
gg.mw.passera.yml                                  22-Feb-2021 12:18                1340
gingergan.com.tournament.yml                       22-Feb-2021 12:18                1236
giraffine.dimmer.yml                               22-Feb-2021 12:18                1166
git.rrgb.kinolog.yml                               22-Feb-2021 12:18                 796
github.daneren2005.dsub.yml                        22-Feb-2021 12:18                6602
github.vatsal.easyweatherdemo.yml                  22-Feb-2021 12:18                 575
github.yaa110.memento.yml                          22-Feb-2021 12:18                 866
github.yaa110.piclice.yml                          22-Feb-2021 12:18                 762
godau.fynn.bandcampdirect.yml                      22-Feb-2021 12:18                 690
godau.fynn.dsbdirect.yml                           22-Feb-2021 12:18                3079
godau.fynn.usagedirect.system.yml                  22-Feb-2021 12:18                 678
godau.fynn.usagedirect.yml                         22-Feb-2021 12:18                1227
goo.TeaTimer.yml                                   22-Feb-2021 12:18                 440
gq.nulldev.animeopenings.app.yml                   22-Feb-2021 12:18                1111
gr.ndre.scuttloid.yml                              22-Feb-2021 12:18                 933
gr.ratmole.android.Mach3Pendant.yml                22-Feb-2021 12:18                 768
grmpl.mk.stepandheightcounter.yml                  22-Feb-2021 12:18                1321
groomiac.crocodilenote.yml                         22-Feb-2021 12:18                1407
hans.b.skewy1_0.yml                                22-Feb-2021 12:18                 474
hashengineering.darkcoin.wallet.yml                22-Feb-2021 12:18                3669
hashengineering.groestlcoin.wallet.yml             22-Feb-2021 12:18                2619
hashengineering.groestlcoin.wallet_test.yml        22-Feb-2021 12:18                2260
headrevision.BehatReporter.yml                     22-Feb-2021 12:18                 682
home.jmstudios.calc.yml                            22-Feb-2021 12:18                1131
horse.amazin.my.stratum0.statuswidget.yml          22-Feb-2021 12:18                1164
host.stjin.anonaddy.yml                            22-Feb-2021 12:18                1120
hr.kravarscan.enchantedfortress.yml                22-Feb-2021 12:18                2852
hsware.HSTempo.yml                                 22-Feb-2021 12:18                 710
hu.tagsoft.ttorrent.search.yml                     22-Feb-2021 12:18                 872
hu.vmiklos.plees_tracker.yml                       22-Feb-2021 12:18                1842
hu.vsza.adsdroid.yml                               22-Feb-2021 12:18                2505
i4nc4mp.myLock.yml                                 22-Feb-2021 12:18                 670
idv.markkuo.ambitsync.yml                          22-Feb-2021 12:18                1751
im.pattle.app.yml                                  22-Feb-2021 12:18                7330
im.quicksy.client.yml                              22-Feb-2021 12:18               16072
im.r_c.android.clearweather.yml                    22-Feb-2021 12:18                 625
im.r_c.android.jigsaw.yml                          22-Feb-2021 12:18                 570
im.status.ethereum.yml                             22-Feb-2021 12:18                1363
im.tox.antox.yml                                   22-Feb-2021 12:18                4245
im.vector.alpha.yml                                22-Feb-2021 12:18              103444
im.vector.app.yml                                  22-Feb-2021 12:18               11473
im.vector.riotx.yml                                22-Feb-2021 12:18                9347
im.zom.messenger.yml                               22-Feb-2021 12:18                8358
in.ac.dducollegedu.shell.yml                       22-Feb-2021 12:18                 588
in.ac.dtu.subtlenews.yml                           22-Feb-2021 12:18                 784
in.ac.iitb.cse.cartsbusboarding.yml                22-Feb-2021 12:18                1213
in.andres.kandroid.yml                             22-Feb-2021 12:18                1603
in.arjsna.permissionchecker.yml                    22-Feb-2021 12:18                 822
in.blogspot.anselmbros.torchie.yml                 22-Feb-2021 12:18                2190
in.indiandragon.shellshock.shellshockvulnerabil..> 22-Feb-2021 12:18                 948
in.p1x.tanks_of_freedom.yml                        22-Feb-2021 12:18               23293
in.shick.diode.yml                                 22-Feb-2021 12:18                1845
in.shick.lockpatterngenerator.yml                  22-Feb-2021 12:18                 887
in.shubhamchaudhary.logmein.yml                    22-Feb-2021 12:18                1147
in.tosc.remotedroid.yml                            22-Feb-2021 12:18                 947
in.umairkhan.remotedroid.yml                       22-Feb-2021 12:18                 721
inc.flide.vi8.yml                                  22-Feb-2021 12:18                 739
inc.flide.vim8.yml                                 22-Feb-2021 12:18                 574
indrora.atomic.yml                                 22-Feb-2021 12:18                1528
info.aario.killcamera.yml                          22-Feb-2021 12:18                 911
info.aario.mywifipasswords.yml                     22-Feb-2021 12:18                1550
info.aario.snotepad.yml                            22-Feb-2021 12:18                1360
info.dvkr.screenstream.yml                         22-Feb-2021 12:18               16525
info.frangor.laicare.yml                           22-Feb-2021 12:18                 908
info.guardianproject.browser.yml                   22-Feb-2021 12:18                2518
info.guardianproject.cacert.yml                    22-Feb-2021 12:18                2336
info.guardianproject.checkey.yml                   22-Feb-2021 12:18                2085
info.guardianproject.courier.yml                   22-Feb-2021 12:18                 929
info.guardianproject.gilga.yml                     22-Feb-2021 12:18                1361
info.guardianproject.gpg.yml                       22-Feb-2021 12:18                2849
info.guardianproject.lildebi.yml                   22-Feb-2021 12:18                4881
info.guardianproject.locationprivacy.yml           22-Feb-2021 12:18                1811
info.guardianproject.notepadbot.yml                22-Feb-2021 12:18                2506
info.guardianproject.orfox.yml                     22-Feb-2021 12:18                1563
info.guardianproject.otr.app.im.yml                22-Feb-2021 12:18                5073
info.guardianproject.pixelknot.yml                 22-Feb-2021 12:18                3341
info.guardianproject.ripple.yml                    22-Feb-2021 12:18                2650
info.kesavan.malartoon.yml                         22-Feb-2021 12:18                 841
info.lamatricexiste.network.yml                    22-Feb-2021 12:18                1212
info.meoblast001.thugaim.yml                       22-Feb-2021 12:18                 820
info.metadude.android.bitsundbaeume.schedule.yml   22-Feb-2021 12:18                1803
info.metadude.android.cccamp.schedule.yml          22-Feb-2021 12:18                2527
info.metadude.android.congress.schedule.yml        22-Feb-2021 12:18                9106
info.metadude.android.datenspuren.schedule.yml     22-Feb-2021 12:18                2767
info.metadude.android.divoc.schedule.yml           22-Feb-2021 12:18                3458
info.metadude.android.fosdem.schedule.yml          22-Feb-2021 12:18                3378
info.metadude.android.rc3.schedule.yml             22-Feb-2021 12:18                2739
info.papdt.blackblub.yml                           22-Feb-2021 12:18                1749
info.puzz.a10000sentences.yml                      22-Feb-2021 12:18                1545
info.schnatterer.nusic.yml                         22-Feb-2021 12:18                2013
info.staticfree.SuperGenPass.yml                   22-Feb-2021 12:18                1247
info.staticfree.android.robotfindskitten.yml       22-Feb-2021 12:18                 771
info.staticfree.android.twentyfourhour.yml         22-Feb-2021 12:18                1038
info.staticfree.android.units.yml                  22-Feb-2021 12:18                1217
info.tangential.cone.yml                           22-Feb-2021 12:18                7923
info.toyonos.hfr4droid.yml                         22-Feb-2021 12:18                 835
info.varden.hauk.yml                               22-Feb-2021 12:18                1938
info.zamojski.soft.towercollector.yml              22-Feb-2021 12:18                6498
info.zwanenburg.caffeinetile.yml                   22-Feb-2021 12:18                1042
io.anuke.mindustry.yml                             22-Feb-2021 12:18                8011
io.davidar.fabularium.yml                          22-Feb-2021 12:18                 617
io.davidar.tensor.yml                              22-Feb-2021 12:18                 764
io.github.alketii.mightyknight.yml                 22-Feb-2021 12:18                1296
io.github.baiatbun.react.yml                       22-Feb-2021 12:18                 745
io.github.benoitduffez.cupsprint.yml               22-Feb-2021 12:18                3064
io.github.chiver.yml                               22-Feb-2021 12:18                 715
io.github.chronosx88.yggdrasil.yml                 22-Feb-2021 12:18                2222
io.github.datastopwatch.yml                        22-Feb-2021 12:18                 499
io.github.deweyreed.clipboardcleaner.yml           22-Feb-2021 12:18                1435
io.github.domi04151309.alwayson.yml                22-Feb-2021 12:18                2338
io.github.domi04151309.batterytool.yml             22-Feb-2021 12:18                 610
io.github.domi04151309.home.yml                    22-Feb-2021 12:18                 893
io.github.domi04151309.podscompanion.yml           22-Feb-2021 12:18                 631
io.github.domi04151309.powerapp.yml                22-Feb-2021 12:18                1110
io.github.droidapps.pdfreader.yml                  22-Feb-2021 12:18                 937
io.github.easyintent.quickref.yml                  22-Feb-2021 12:18                 510
io.github.engsergiu.react.yml                      22-Feb-2021 12:18                1057
io.github.folderlogs.yml                           22-Feb-2021 12:18                 468
io.github.froodyapp.yml                            22-Feb-2021 12:18                3478
io.github.fvasco.pinpoi.yml                        22-Feb-2021 12:18               10756
io.github.gsantner.memetastic.yml                  22-Feb-2021 12:18                5489
io.github.hasheazy.yml                             22-Feb-2021 12:18                 484
io.github.hidroh.materialistic.yml                 22-Feb-2021 12:18                3143
io.github.hopedia.yml                              22-Feb-2021 12:18                 804
io.github.installalogs.yml                         22-Feb-2021 12:18                 476
io.github.ismywebsiteup.yml                        22-Feb-2021 12:18                 500
io.github.kobuge.games.minilens.yml                22-Feb-2021 12:18                3298
io.github.lonamiwebs.klooni.yml                    22-Feb-2021 12:18                2422
io.github.lonamiwebs.stringlate.yml                22-Feb-2021 12:18                3839
io.github.lufte.lona.yml                           22-Feb-2021 12:18                 629
io.github.mthli.Ninja.yml                          22-Feb-2021 12:18                 919
io.github.muntashirakon.AppManager.yml             22-Feb-2021 12:18                1773
io.github.muntashirakon.Music.yml                  22-Feb-2021 12:18                 525
io.github.muntashirakon.setedit.yml                22-Feb-2021 12:18                 605
io.github.muntashirakon.unapkm.yml                 22-Feb-2021 12:18                1183
io.github.otakuchiyan.dnsman.yml                   22-Feb-2021 12:18                1568
io.github.otobikb.inputmethod.latin.yml            22-Feb-2021 12:18                 614
io.github.pd4d10.gittouch.yml                      22-Feb-2021 12:18                1915
io.github.phora.aeondroid.yml                      22-Feb-2021 12:18                 868
io.github.phora.androptpb.yml                      22-Feb-2021 12:18                 984
io.github.powerinside.scrollsocket.yml             22-Feb-2021 12:18                1199
io.github.powerinside.syncplay.yml                 22-Feb-2021 12:18                2476
io.github.project_travel_mate.yml                  22-Feb-2021 12:18                1811
io.github.randomfilemaker.yml                      22-Feb-2021 12:18                 504
io.github.sanbeg.flashlight.yml                    22-Feb-2021 12:18                 893
io.github.saveastxt.yml                            22-Feb-2021 12:18                 462
io.github.sds100.keymapper.inputmethod.latin.yml   22-Feb-2021 12:18                 646
io.github.sds100.keymapper.yml                     22-Feb-2021 12:18                2081
io.github.silinote.yml                             22-Feb-2021 12:18                 461
io.github.subhamtyagi.lastlauncher.yml             22-Feb-2021 12:18                2640
io.github.subhamtyagi.nightmode.yml                22-Feb-2021 12:18                 734
io.github.subhamtyagi.ocr.yml                      22-Feb-2021 12:18                 838
io.github.subhamtyagi.openinwhatsapp.yml           22-Feb-2021 12:18                1389
io.github.subhamtyagi.privacyapplock.yml           22-Feb-2021 12:18                1550
io.github.thachillera.cardsscorekeeper.yml         22-Feb-2021 12:18                 555
io.github.tiagoshibata.gpsdclient.yml              22-Feb-2021 12:18                1588
io.github.tjg1.nori.yml                            22-Feb-2021 12:18                2205
io.github.tompreuss.apnsettings.yml                22-Feb-2021 12:18                 532
io.github.trytonvanmeer.libretrivia.yml            22-Feb-2021 12:18                 793
io.github.webbluetoothcg.bletestperipheral.yml     22-Feb-2021 12:18                1185
io.github.whirish.tvbuses.yml                      22-Feb-2021 12:18                1205
io.github.wulkanowy.yml                            22-Feb-2021 12:18               15851
io.github.x0b.rcx.yml                              22-Feb-2021 12:18                1479
io.github.z3r0c00l_2k.aquadroid.yml                22-Feb-2021 12:18                 718
io.githubfede0d.planetrider.yml                    22-Feb-2021 12:18                1652
io.gitlab.allenb1.todolist.yml                     22-Feb-2021 12:18                 520
io.gitlab.danielrparks.vibrato.yml                 22-Feb-2021 12:18                 677
io.gitlab.mudassir.youtubecacher.yml               22-Feb-2021 12:18                 750
io.gresse.hugo.anecdote.yml                        22-Feb-2021 12:18                4146
io.homeassistant.android.yml                       22-Feb-2021 12:18                1604
io.homeassistant.companion.android.minimal.yml     22-Feb-2021 12:18                3216
io.infinyte7.ankiimageocclusion.yml                22-Feb-2021 12:18                 550
io.kuenzler.whatsappwebtogo.yml                    22-Feb-2021 12:18                1061
io.lbry.browser.yml                                22-Feb-2021 12:18                5453
io.librehealth.toolkit.cost_of_care.yml            22-Feb-2021 12:18                1948
io.mainframe.hacs.yml                              22-Feb-2021 12:18                1395
io.mkg20001.arubanetworkslogin.yml                 22-Feb-2021 12:18                 793
io.mrarm.irc.yml                                   22-Feb-2021 12:18                2463
io.nandandesai.privacybreacher.yml                 22-Feb-2021 12:18                 526
io.neurolab.yml                                    22-Feb-2021 12:18                 518
io.oversec.one.yml                                 22-Feb-2021 12:18                3743
io.pslab.yml                                       22-Feb-2021 12:18                2365
io.simplelogin.android.fdroid.yml                  22-Feb-2021 12:18                 865
io.timelimit.android.aosp.direct.yml               22-Feb-2021 12:18                2916
io.timelimit.android.open.yml                      22-Feb-2021 12:18                5031
io.tiph.smsspammer.yml                             22-Feb-2021 12:18                 748
io.treehouses.remote.yml                           22-Feb-2021 12:18               10758
io.trezor.app.yml                                  22-Feb-2021 12:18                3602
io.va.exposed.yml                                  22-Feb-2021 12:18                3708
io.vertretungsplan.client.android.yml              22-Feb-2021 12:18                 836
io.wookey.wallet.yml                               22-Feb-2021 12:18                2192
ir.hsn6.defendo.yml                                22-Feb-2021 12:18                3028
ir.hsn6.k2.yml                                     22-Feb-2021 12:18                1448
ir.hsn6.tpb.yml                                    22-Feb-2021 12:18                4731
ir.hsn6.trans.yml                                  22-Feb-2021 12:18                1452
ir.hsn6.turo.yml                                   22-Feb-2021 12:18                3175
ir.mrahimy.conceal.yml                             22-Feb-2021 12:18                 501
is.pinterjann.jaws.yml                             22-Feb-2021 12:18                1605
is.xyz.mpv.yml                                     22-Feb-2021 12:18                 889
is.xyz.omw.yml                                     22-Feb-2021 12:18                5926
is.xyz.omw_nightly.yml                             22-Feb-2021 12:18               23613
is.xyz.vcmi.yml                                    22-Feb-2021 12:18               18579
is.zi.huewidgets.yml                               22-Feb-2021 12:18                 798
isn.fly.speedmeter.yml                             22-Feb-2021 12:18                1183
it.alessandropira.wesnoth114.yml                   22-Feb-2021 12:18                4351
it.andreascarpino.forvodroid.yml                   22-Feb-2021 12:18                2721
it.andreascarpino.hostisdown.yml                   22-Feb-2021 12:18                 849
it.angrydroids.epub3reader.yml                     22-Feb-2021 12:18                1241
it.collideorscopeapps.codename_hippopotamos.yml    22-Feb-2021 12:18                1068
it.devapp.android.yml                              22-Feb-2021 12:18                 858
it.diab.yml                                        22-Feb-2021 12:18                1522
it.ecosw.dudo.yml                                  22-Feb-2021 12:18                1722
it.eternitywall.eternitywall.yml                   22-Feb-2021 12:18                 901
it.fabmazz.triestebus.yml                          22-Feb-2021 12:18                 968
it.faerb.crond.yml                                 22-Feb-2021 12:18                1400
it.feio.android.omninotes.foss.yml                 22-Feb-2021 12:18                4835
it.fossoft.timberfoss.yml                          22-Feb-2021 12:18                1189
it.gmariotti.android.apps.dashclock.extensions...> 22-Feb-2021 12:18                 826
it.greenaddress.cordova.yml                        22-Feb-2021 12:18                9530
it.iiizio.epubator.yml                             22-Feb-2021 12:18                2174
it.langolonerd.app.yml                             22-Feb-2021 12:18                 830
it.linuxday.torino.yml                             22-Feb-2021 12:18                1217
it.lucci.cm.greyscaletheme.yml                     22-Feb-2021 12:18                1605
it.mn.salvi.linuxDayOSM.yml                        22-Feb-2021 12:18                 596
it.mobimentum.dualsimwidget.yml                    22-Feb-2021 12:18                1215
it.niedermann.nextcloud.deck.yml                   22-Feb-2021 12:18                7491
it.niedermann.owncloud.notes.yml                   22-Feb-2021 12:18               11394
it.reyboz.bustorino.yml                            22-Feb-2021 12:18                4071
it.reyboz.chordshift.yml                           22-Feb-2021 12:18                1059
it.reyboz.minesweeper.yml                          22-Feb-2021 12:18                2711
it.reyboz.screenlock.yml                           22-Feb-2021 12:18                1214
it.rgp.nyagua.pafcalc.yml                          22-Feb-2021 12:18                1451
it.rignanese.leo.slimfacebook.yml                  22-Feb-2021 12:18                2997
it.rignanese.leo.slimtwitter.yml                   22-Feb-2021 12:18                1717
it.sasabz.android.sasabus.yml                      22-Feb-2021 12:18                2715
it.sieke.android.cacertorgcertificateinstaller.yml 22-Feb-2021 12:18                 882
it.sineo.android.noFrillsCPUClassic.yml            22-Feb-2021 12:18                1519
it.skarafaz.mercury.yml                            22-Feb-2021 12:18                1993
italian.said.fran.theitaliansaid.yml               22-Feb-2021 12:18                 586
itkach.aard2.yml                                   22-Feb-2021 12:18                3539
ivl.android.moneybalance.yml                       22-Feb-2021 12:18                1343
jackpal.androidterm.yml                            22-Feb-2021 12:18                4550
jackpal.droidexaminer.yml                          22-Feb-2021 12:18                 611
jl.musicalnotes.yml                                22-Feb-2021 12:18                 828
jonas.tool.saveForOffline.yml                      22-Feb-2021 12:18                2616
joshuatee.wx.yml                                   22-Feb-2021 12:18               11989
jp.co.kayo.android.localplayer.ds.ampache.yml      22-Feb-2021 12:18                1132
jp.co.kayo.android.localplayer.ds.podcast.yml      22-Feb-2021 12:18                 822
jp.co.kayo.android.localplayer.yml                 22-Feb-2021 12:18                6401
jp.co.omronsoft.openwnn.yml                        22-Feb-2021 12:18                1898
jp.co.qsdn.android.jinbei3d.yml                    22-Feb-2021 12:18                1837
jp.ddo.hotmist.unicodepad.yml                      22-Feb-2021 12:18                1325
jp.forkhub.yml                                     22-Feb-2021 12:18                8980
jp.gr.java_conf.hatalab.mnv.yml                    22-Feb-2021 12:18                 754
jp.ksksue.app.terminal.yml                         22-Feb-2021 12:18                1706
jp.muo.syncmemories.yml                            22-Feb-2021 12:18                 535
jp.redmine.redmineclient.yml                       22-Feb-2021 12:18                3128
jp.sawada.np2android.yml                           22-Feb-2021 12:18                1396
jp.sblo.pandora.aGrep.yml                          22-Feb-2021 12:18                1571
jp.sfjp.webglmol.NDKmol.yml                        22-Feb-2021 12:18                1406
jp.softstudio.DriversLicenseReader.yml             22-Feb-2021 12:18                 728
jp.takke.cpustats.yml                              22-Feb-2021 12:18                1758
jp.takke.datastats.yml                             22-Feb-2021 12:18                2190
jp.yhonda.yml                                      22-Feb-2021 12:18                2577
jpf.android.diary.yml                              22-Feb-2021 12:18                 956
jpf.android.magiadni.yml                           22-Feb-2021 12:18                1099
julianwi.javainstaller.yml                         22-Feb-2021 12:18                1198
juliushenke.smarttt.yml                            22-Feb-2021 12:18                1329
jupiter.broadcasting.live.tv.yml                   22-Feb-2021 12:18                1247
jwtc.android.chess.yml                             22-Feb-2021 12:18                1815
kaba.yucata.envoy.yml                              22-Feb-2021 12:18                1449
kaljurand_at_gmail_dot_com.diktofon.yml            22-Feb-2021 12:18                1868
kdk.android.simplydo.yml                           22-Feb-2021 12:18                 643
kellinwood.zipsigner2.yml                          22-Feb-2021 12:18                1055
kiwi.root.an2linuxclient.yml                       22-Feb-2021 12:18                2266
kmac.dejavu_fonts.yml                              22-Feb-2021 12:18                 733
koeln.mop.elpeefpe.yml                             22-Feb-2021 12:18                 691
kr.hybdms.sidepanel.yml                            22-Feb-2021 12:18                1289
kr.softgear.multiping.yml                          22-Feb-2021 12:18                 933
krasilnikov.alexey.cryptopass.yml                  22-Feb-2021 12:18                1331
kvj.taskw.yml                                      22-Feb-2021 12:18                2503
la.daube.photochiotte.yml                          22-Feb-2021 12:18                1735
lanchon.sigspoof.checker.yml                       22-Feb-2021 12:18                1028
li.klass.fhem.yml                                  22-Feb-2021 12:18                2528
libretasks.app.yml                                 22-Feb-2021 12:18                1371
link.standen.michael.fatesheets.yml                22-Feb-2021 12:18                2171
link.standen.michael.phonesaver.yml                22-Feb-2021 12:18                3439
link.standen.michael.slideshow.yml                 22-Feb-2021 12:18                4588
ltd.evilcorp.atox.yml                              22-Feb-2021 12:18                 524
lu.cases.tacos.yml                                 22-Feb-2021 12:18                1780
luke.launcher.yml                                  22-Feb-2021 12:18                 982
makeinfo.com.getid.yml                             22-Feb-2021 12:18                 686
mancioboxblog.altervista.it.volumecontrol.yml      22-Feb-2021 12:18                 706
marto.rtl_tcp_andro.yml                            22-Feb-2021 12:18                1862
mattecarra.accapp.yml                              22-Feb-2021 12:18                2455
mavonst.app.easylight.yml                          22-Feb-2021 12:18                 884
max.music_cyclon.yml                               22-Feb-2021 12:18                 960
mazechazer.android.wottankquiz.yml                 22-Feb-2021 12:18                1004
mbmb5.lumixextendedcontrolapp.yml                  22-Feb-2021 12:18                 921
me.alexghr.android.bulkshare.yml                   22-Feb-2021 12:18                 944
me.alexghr.bulkshare.android.app2.yml              22-Feb-2021 12:18                 879
me.anon.grow.yml                                   22-Feb-2021 12:18                1435
me.anuraag.grader.yml                              22-Feb-2021 12:18                1014
me.anuraag.loveactualized.yml                      22-Feb-2021 12:18                 835
me.austinhuang.instagrabber.yml                    22-Feb-2021 12:18                1899
me.billdietrich.fake_contacts.yml                  22-Feb-2021 12:18                1093
me.blog.korn123.easydiary.yml                      22-Feb-2021 12:18                5222
me.bpear.archonpackager.yml                        22-Feb-2021 12:18                 964
me.ccrama.redditslide.yml                          22-Feb-2021 12:18               15992
me.cgarcia.yarr.yml                                22-Feb-2021 12:18                 516
me.danielbarnett.addresstogps.yml                  22-Feb-2021 12:18                1970
me.dbarnett.acastus.yml                            22-Feb-2021 12:18                2422
me.echeung.cdflabs.yml                             22-Feb-2021 12:18                3308
me.echeung.moemoekyun.fdroid.yml                   22-Feb-2021 12:18                3940
me.guillaumin.android.osmtracker.yml               22-Feb-2021 12:18                3001
me.hackerchick.catima.yml                          22-Feb-2021 12:18                1849
me.hackerchick.raisetoanswer.yml                   22-Feb-2021 12:18                1633
me.hackerchick.sharetoinputstick.yml               22-Feb-2021 12:18                1379
me.hda.urlhda.yml                                  22-Feb-2021 12:18                1180
me.iacn.mbestyle.yml                               22-Feb-2021 12:18                 864
me.impa.knockonports.yml                           22-Feb-2021 12:18                2548
me.jakelane.wrapperforfacebook.yml                 22-Feb-2021 12:18                1005
me.jamesfrost.simpledo.yml                         22-Feb-2021 12:18                1455
me.jfenn.alarmio.yml                               22-Feb-2021 12:18                1176
me.johnmh.boogdroid.yml                            22-Feb-2021 12:18                 889
me.kavishhukmani.watwitchstickers.yml              22-Feb-2021 12:18                1875
me.kuehle.carreport.yml                            22-Feb-2021 12:18               10042
me.malladi.dashcricket.yml                         22-Feb-2021 12:18                1456
me.murks.feedwatcher.yml                           22-Feb-2021 12:18                2212
me.murks.filmchecker.yml                           22-Feb-2021 12:18                2623
me.phh.superuser.yml                               22-Feb-2021 12:18                1439
me.ranko.autodark.yml                              22-Feb-2021 12:18                 681
me.rosuh.easywatermark.yml                         22-Feb-2021 12:18                 623
me.sheimi.sgit.yml                                 22-Feb-2021 12:18                1318
me.shrimadhavuk.numselapp.yml                      22-Feb-2021 12:18                 816
me.shrimadhavuk.watransmitter.yml                  22-Feb-2021 12:18                1106
me.thanel.dank.yml                                 22-Feb-2021 12:18                 776
me.tripsit.tripmobile.yml                          22-Feb-2021 12:18                2863
me.tsukanov.counter.yml                            22-Feb-2021 12:18                1617
me.wenxinwang.pulsedroidrtp.yml                    22-Feb-2021 12:18                1103
me.wolszon.fastshopping.yml                        22-Feb-2021 12:18                5680
me.writeily.pro.yml                                22-Feb-2021 12:18                1897
me.writeily.yml                                    22-Feb-2021 12:18                1187
me.zeeroooo.materialfb.yml                         22-Feb-2021 12:18                5164
me.zhanghai.android.files.yml                      22-Feb-2021 12:18                2675
menion.android.whereyougo.yml                      22-Feb-2021 12:18                2319
mf.asciitext.lite.yml                              22-Feb-2021 12:18                 709
mixedbit.speechtrainer.yml                         22-Feb-2021 12:18                 893
mkg20001.net.samremote.yml                         22-Feb-2021 12:18                1161
ml.adamsprogs.bimba.yml                            22-Feb-2021 12:18                2344
ml.docilealligator.infinityforreddit.yml           22-Feb-2021 12:18                1484
mn.tck.semitone.yml                                22-Feb-2021 12:18                1699
mobi.boilr.boilr.yml                               22-Feb-2021 12:18                5938
mobi.cyann.nstools.yml                             22-Feb-2021 12:18                 620
mobi.maptrek.yml                                   22-Feb-2021 12:18                2107
mobi.omegacentauri.PerApp.yml                      22-Feb-2021 12:18                 759
mobi.omegacentauri.SendReduced.yml                 22-Feb-2021 12:18                4016
moe.dic1911.urlsanitizer.yml                       22-Feb-2021 12:18                 867
moe.feng.nhentai.yml                               22-Feb-2021 12:18                2369
moe.martini.midictrl.yml                           22-Feb-2021 12:18                 709
moe.minori.pgpclipper.yml                          22-Feb-2021 12:18                1314
mohammad.adib.roundr.yml                           22-Feb-2021 12:18                2088
monakhv.android.samlib.yml                         22-Feb-2021 12:18                 987
mono.hg.yml                                        22-Feb-2021 12:18                2539
naman14.timber.yml                                 22-Feb-2021 12:18                2434
name.bagi.levente.pedometer.yml                    22-Feb-2021 12:18                 727
name.boyle.chris.sgtpuzzles.yml                    22-Feb-2021 12:18                3382
name.gdr.acastus_photon.yml                        22-Feb-2021 12:18                1573
name.juodumas.ext_kbd_lithuanian.yml               22-Feb-2021 12:18                 997
name.livitski.games.puzzle.android.yml             22-Feb-2021 12:18                1024
name.marfl.ext_kbd_bulgarian_phonetic.yml          22-Feb-2021 12:18                1375
name.myigel.fahrplan.eh17.yml                      22-Feb-2021 12:18                 916
name.seguri.android.getforegroundactivity.yml      22-Feb-2021 12:18                 848
name.seguri.android.isphoneencrypted.yml           22-Feb-2021 12:18                 548
name.seguri.android.lock.yml                       22-Feb-2021 12:18                1463
name.soulayrol.rhaa.sholi.yml                      22-Feb-2021 12:18                1906
name.starnberger.guenther.android.cbw.yml          22-Feb-2021 12:18                 785
namlit.siteswapgenerator.yml                       22-Feb-2021 12:18                2580
nds.fyll.puzzle_grid.yml                           22-Feb-2021 12:18                1909
negativedensity.techahashi.yml                     22-Feb-2021 12:18                1003
nerd.tuxmobil.fahrplan.camp.yml                    22-Feb-2021 12:18                1846
nerd.tuxmobil.fahrplan.congress.yml                22-Feb-2021 12:18                3235
net.aangle.rvclock.yml                             22-Feb-2021 12:18                 502
net.alaindonesia.silectric.yml                     22-Feb-2021 12:18                1196
net.alegen.android.netclip.yml                     22-Feb-2021 12:18                 998
net.androcom.dho.speakerproximity.yml              22-Feb-2021 12:18                 783
net.androgames.level.yml                           22-Feb-2021 12:18                1680
net.androidcomics.acv.yml                          22-Feb-2021 12:18                1333
net.anzix.osm.upload.yml                           22-Feb-2021 12:18                1185
net.artificialworlds.rabbitescape.yml              22-Feb-2021 12:18                2356
net.asceai.meritous.yml                            22-Feb-2021 12:18                2275
net.avs234.yml                                     22-Feb-2021 12:18                 660
net.basov.lws.fdroid.yml                           22-Feb-2021 12:18                4587
net.basov.lws.qr.fdroid.yml                        22-Feb-2021 12:18                1850
net.bible.android.activity.yml                     22-Feb-2021 12:18               25262
net.bierbaumer.otp_authenticator.yml               22-Feb-2021 12:18                1297
net.bitconomy.ckpoolwatcher.yml                    22-Feb-2021 12:18                 674
net.bitplane.android.microphone.yml                22-Feb-2021 12:18                 820
net.bluetoothviewer.yml                            22-Feb-2021 12:18                1881
net.bmaron.openfixmap.yml                          22-Feb-2021 12:18                1123
net.bytten.xkcdviewer.yml                          22-Feb-2021 12:18                1819
net.cactii.mathdoku.yml                            22-Feb-2021 12:18                 862
net.chilon.matt.teacup.yml                         22-Feb-2021 12:18                1222
net.codechunk.speedofsound.yml                     22-Feb-2021 12:18                2141
net.commotionwireless.meshtether.yml               22-Feb-2021 12:18                 768
net.currit.tonality.yml                            22-Feb-2021 12:18                1161
net.cyclestreets.yml                               22-Feb-2021 12:18                1834
net.czlee.debatekeeper.yml                         22-Feb-2021 12:18                1995
net.dahanne.android.regalandroid.yml               22-Feb-2021 12:18                2362
net.dahanne.banq.notifications.yml                 22-Feb-2021 12:18                1522
net.damsy.soupeaucaillou.heriswap.yml              22-Feb-2021 12:18                2258
net.damsy.soupeaucaillou.recursiveRunner.yml       22-Feb-2021 12:18                1718
net.daverix.urlforward.yml                         22-Feb-2021 12:18                1504
net.dcnnt.yml                                      22-Feb-2021 12:18                 897
net.ddns.mlsoftlaberge.trycorder.yml               22-Feb-2021 12:18                4567
net.debian.debiandroid.yml                         22-Feb-2021 12:18                3147
net.ebt.muzei.miyazaki.yml                         22-Feb-2021 12:18                1899
net.eneiluj.moneybuster.yml                        22-Feb-2021 12:18                3860
net.eneiluj.nextcloud.phonetrack.yml               22-Feb-2021 12:18                2987
net.etuldan.sparss.floss.yml                       22-Feb-2021 12:18               10677
net.everythingandroid.smspopup.yml                 22-Feb-2021 12:18                2334
net.fabiszewski.ulogger.yml                        22-Feb-2021 12:18                3917
net.fercanet.LNM.yml                               22-Feb-2021 12:18                 431
net.fred.feedex.yml                                22-Feb-2021 12:18                8193
net.frju.flym.yml                                  22-Feb-2021 12:18                4056
net.frju.verdure.yml                               22-Feb-2021 12:18                 987
net.gaast.giggity.yml                              22-Feb-2021 12:18                3424
net.gcompris.full.yml                              22-Feb-2021 12:18               10739
net.georgewhiteside.android.abstractart.yml        22-Feb-2021 12:18                1110
net.glsk.wpgen.yml                                 22-Feb-2021 12:18                1406
net.gorry.aicia.yml                                22-Feb-2021 12:18                 873
net.gorry.android.input.nicownng.yml               22-Feb-2021 12:18                1660
net.gsantner.dandelior.yml                         22-Feb-2021 12:18                1202
net.gsantner.markor.yml                            22-Feb-2021 12:18               11099
net.guildem.publicip.yml                           22-Feb-2021 12:18                1042
net.haltcondition.anode.yml                        22-Feb-2021 12:18                 508
net.healeys.lexic.yml                              22-Feb-2021 12:18                 655
net.i2p.android.router.yml                         22-Feb-2021 12:18               22728
net.i2p.android.yml                                22-Feb-2021 12:18                1958
net.iexos.musicalarm.yml                           22-Feb-2021 12:18                 731
net.imatruck.betterweather.yml                     22-Feb-2021 12:18                2733
net.inbox.pager.yml                                22-Feb-2021 12:18                2614
net.iowaline.dotdash.yml                           22-Feb-2021 12:18                2329
net.ivpn.client.yml                                22-Feb-2021 12:18                2400
net.jakevossen.apollotrivia.yml                    22-Feb-2021 12:18                1100
net.jaqpot.netcounter.yml                          22-Feb-2021 12:18                 600
net.jjc1138.android.scrobbler.yml                  22-Feb-2021 12:18                1015
net.justdave.nwsweatheralertswidget.yml            22-Feb-2021 12:18                2587
net.kervala.comicsreader.yml                       22-Feb-2021 12:18                2923
net.khertan.forrunners.yml                         22-Feb-2021 12:18                1603
net.kismetwireless.android.smarterwifimanager.yml  22-Feb-2021 12:18                1708
net.kollnig.missioncontrol.fdroid.yml              22-Feb-2021 12:18                4161
net.kourlas.voipms_sms.yml                         22-Feb-2021 12:18                3941
net.ktnx.mobileledger.yml                          22-Feb-2021 12:18                2327
net.lardcave.keepassnfc.yml                        22-Feb-2021 12:18                 924
net.loeuillet.wifi_eap_sim_conf.yml                22-Feb-2021 12:18                 780
net.logomancy.dashquotes.civ5.yml                  22-Feb-2021 12:18                 885
net.logomancy.diedroid.yml                         22-Feb-2021 12:18                 984
net.luniks.android.inetify.yml                     22-Feb-2021 12:18                1291
net.mabako.steamgifts.yml                          22-Feb-2021 12:18                4021
net.mafro.android.wakeonlan.yml                    22-Feb-2021 12:18                 865
net.majorkernelpanic.spydroid.yml                  22-Feb-2021 12:18                2013
net.mcarolan.whenzebus.yml                         22-Feb-2021 12:18                 628
net.micode.compass.yml                             22-Feb-2021 12:18                 492
net.micode.fileexplorer.yml                        22-Feb-2021 12:18                 659
net.micode.soundrecorder.yml                       22-Feb-2021 12:18                 642
net.minetest.minetest.yml                          22-Feb-2021 12:18                6759
net.moasdawiki.app.yml                             22-Feb-2021 12:18                1268
net.momodalo.app.vimtouch.yml                      22-Feb-2021 12:18                2239
net.mullvad.mullvadvpn.yml                         22-Feb-2021 12:18                2055
net.mypapit.mobile.myposition.yml                  22-Feb-2021 12:18                1562
net.nhiroki.bluelineconsole.yml                    22-Feb-2021 12:18                1151
net.nightwhistler.pageturner.yml                   22-Feb-2021 12:18                5402
net.nitroshare.android.yml                         22-Feb-2021 12:18                1245
net.noio.Reminder.yml                              22-Feb-2021 12:18                1299
net.nullsum.audinaut.yml                           22-Feb-2021 12:18                2278
net.nullsum.freedoom.yml                           22-Feb-2021 12:18                1442
net.nurik.roman.dashclock.yml                      22-Feb-2021 12:18                3376
net.nurik.roman.muzei.yml                          22-Feb-2021 12:18                3191
net.olejon.mdapp.yml                               22-Feb-2021 12:18                4113
net.olejon.spotcommander.yml                       22-Feb-2021 12:18                4744
net.opendasharchive.openarchive.release.yml        22-Feb-2021 12:18                1323
net.oschina.app.yml                                22-Feb-2021 12:18                 705
net.osmand.parkingPlugin.yml                       22-Feb-2021 12:18                 947
net.osmand.plus.yml                                22-Feb-2021 12:18              210305
net.osmand.srtmPlugin.paid.yml                     22-Feb-2021 12:18                1487
net.osmtracker.yml                                 22-Feb-2021 12:18                1636
net.pagekite.app.yml                               22-Feb-2021 12:18                1326
net.pejici.easydice.yml                            22-Feb-2021 12:18                1718
net.pejici.summation.yml                           22-Feb-2021 12:18                 783
net.pfiers.osmfocus.yml                            22-Feb-2021 12:18                 439
net.pherth.omnomagon.yml                           22-Feb-2021 12:18                2075
net.phunehehe.foocam.yml                           22-Feb-2021 12:18                 849
net.pierrox.mcompass.yml                           22-Feb-2021 12:18                 466
net.pmarks.chromadoze.yml                          22-Feb-2021 12:18                3676
net.pp3345.ykdroid.yml                             22-Feb-2021 12:18                1109
net.programmierecke.radiodroid2.yml                22-Feb-2021 12:18                8724
net.progval.android.andquote.yml                   22-Feb-2021 12:18                1066
net.ralphbroenink.muzei.unsplash.yml               22-Feb-2021 12:18                 830
net.redsolver.noteless.yml                         22-Feb-2021 12:18                1122
net.redwarp.gifwallpaper.yml                       22-Feb-2021 12:18                1309
net.reichholf.dreamdroid.yml                       22-Feb-2021 12:18                2568
net.rocboronat.android.wallpaper.npe.yml           22-Feb-2021 12:18                1021
net.rocrail.androc.yml                             22-Feb-2021 12:18                4510
net.schueller.instarepost.yml                      22-Feb-2021 12:18                1034
net.schueller.peertube.yml                         22-Feb-2021 12:18                5264
net.scintill.duotp.yml                             22-Feb-2021 12:18                 542
net.screenfreeze.deskcon.yml                       22-Feb-2021 12:18                1108
net.sf.andbatdog.batterydog.yml                    22-Feb-2021 12:18                 874
net.sf.andhsli.hotspotlogin.yml                    22-Feb-2021 12:18                1008
net.sf.crypt.gort.yml                              22-Feb-2021 12:18                 625
net.sf.ethersynth.yml                              22-Feb-2021 12:18                1187
net.sf.times.yml                                   22-Feb-2021 12:18                2084
net.solutinno.websearch.yml                        22-Feb-2021 12:18                1842
net.somethingdreadful.MAL.yml                      22-Feb-2021 12:18                2598
net.sourceforge.andsys.yml                         22-Feb-2021 12:18                1538
net.sourceforge.dibdib.android.dib2qm.yml          22-Feb-2021 12:18                2057
net.sourceforge.kid3.yml                           22-Feb-2021 12:18               12383
net.sourceforge.opencamera.yml                     22-Feb-2021 12:18                5259
net.sourceforge.servestream.yml                    22-Feb-2021 12:18                6427
net.sourceforge.solitaire_cg.yml                   22-Feb-2021 12:18                2266
net.sourceforge.subsonic.androidapp.yml            22-Feb-2021 12:18                1560
net.sourceforge.wifiremoteplay.yml                 22-Feb-2021 12:18                1876
net.sourceforge.x11basic.yml                       22-Feb-2021 12:18                1305
net.stkaddons.viewer.yml                           22-Feb-2021 12:18                 903
net.sylvek.sharemyposition.yml                     22-Feb-2021 12:18                1382
net.syncthing.lite.yml                             22-Feb-2021 12:18                2766
net.syntaxblitz.plucklock.yml                      22-Feb-2021 12:18                1424
net.szym.barnacle.yml                              22-Feb-2021 12:18                1044
net.taler.cashier.yml                              22-Feb-2021 12:18                 753
net.taler.merchantpos.yml                          22-Feb-2021 12:18                 840
net.taler.wallet.fdroid.yml                        22-Feb-2021 12:18                1640
net.tapi.handynotes.yml                            22-Feb-2021 12:18                1017
net.tedstein.AndroSS.yml                           22-Feb-2021 12:18                1521
net.teknoraver.andhrystone.yml                     22-Feb-2021 12:18                1035
net.tevp.postcode.yml                              22-Feb-2021 12:18                1025
net.thauvin.erik.android.noussd.yml                22-Feb-2021 12:18                1176
net.tjado.passwdsafe.yml                           22-Feb-2021 12:18                1247
net.typeblog.shelter.yml                           22-Feb-2021 12:18                4797
net.usikkert.kouchat.android.yml                   22-Feb-2021 12:18                2402
net.vivekiyer.GAL.yml                              22-Feb-2021 12:18                1242
net.vonforst.evmap.yml                             22-Feb-2021 12:18                2080
net.vreeken.quickmsg.yml                           22-Feb-2021 12:18                1996
net.wigle.wigleandroid.yml                         22-Feb-2021 12:18                5137
net.wireloss.android.fahrplan.pw16.yml             22-Feb-2021 12:18                 836
net.xenotropic.quizznworldcap.yml                  22-Feb-2021 12:18                 717
net.xtlive.EDL.Dashboard.yml                       22-Feb-2021 12:18                 773
net.xvello.salasana.yml                            22-Feb-2021 12:18                1331
net.yolosec.routerkeygen2.yml                      22-Feb-2021 12:18                1026
net.yxejamir.misbotheringsms.yml                   22-Feb-2021 12:18                 934
net.zygotelabs.locker.yml                          22-Feb-2021 12:18                1882
network.ubic.ubic.yml                              22-Feb-2021 12:18                4720
news.androidtv.launchonboot.yml                    22-Feb-2021 12:18                 757
nf.frex.android.yml                                22-Feb-2021 12:18                 561
nightlock.peppercarrot.yml                         22-Feb-2021 12:18                1548
nitezh.ministock.yml                               22-Feb-2021 12:18                3031
nl.asymmetrics.droidshows.yml                      22-Feb-2021 12:18                6568
nl.devluuk.sleepywifi.yml                          22-Feb-2021 12:18                1390
nl.eventinfra.wifisetup.yml                        22-Feb-2021 12:18                1093
nl.frankkie.bronylivewallpaper.yml                 22-Feb-2021 12:18                1059
nl.implode.regenalarm.yml                          22-Feb-2021 12:18                1453
nl.implode.weer.yml                                22-Feb-2021 12:18                2183
nl.mpcjanssen.simpletask.webdav.yml                22-Feb-2021 12:18                1834
nl.mpcjanssen.simpletask.yml                       22-Feb-2021 12:18               19240
nl.patrickkostjens.kandroid.yml                    22-Feb-2021 12:18                 620
nl.sogeti.android.gpstracker.yml                   22-Feb-2021 12:18                1012
nl.ttys0.simplec25k.yml                            22-Feb-2021 12:18                 914
nl.yoerinijs.notebuddy.yml                         22-Feb-2021 12:18                2445
no.rkkc.bysykkel.yml                               22-Feb-2021 12:18                1511
nodom.darkfm.inventoryguimobile.yml                22-Feb-2021 12:18                 539
nodomain.freeyourgadget.gadgetbridge.yml           22-Feb-2021 12:18               20436
nodomain.freeyourgadget.tpmsmonitor.yml            22-Feb-2021 12:18                 957
nodomain.vanous.blitztypekeyboard.yml              22-Feb-2021 12:18                 556
nu.firetech.android.pactrack.yml                   22-Feb-2021 12:18                 782
nu.firetech.android.wifiwarning.yml                22-Feb-2021 12:18                 615
nya.kitsunyan.foxydroid.yml                        22-Feb-2021 12:18                 847
nya.miku.wishmaster.yml                            22-Feb-2021 12:18                5998
nz.gen.geek_central.ObjViewer.yml                  22-Feb-2021 12:18                1160
nz.org.cacophony.birdmonitor.yml                   22-Feb-2021 12:18                 898
ohi.andre.consolelauncher.yml                      22-Feb-2021 12:18                9611
ohm.quickdice.yml                                  22-Feb-2021 12:18                2771
one.librem.chat.yml                                22-Feb-2021 12:18                1494
one.librem.mail.yml                                22-Feb-2021 12:18                 875
one.librem.social.multi.yml                        22-Feb-2021 12:18                 996
one.librem.social.yml                              22-Feb-2021 12:18                1003
one.librem.tunnel.yml                              22-Feb-2021 12:18                 765
online.xournal.mobile.yml                          22-Feb-2021 12:18                1577
open.com.permissionsmanager.yml                    22-Feb-2021 12:18                 594
opencontacts.open.com.opencontacts.yml             22-Feb-2021 12:18                3060
openfoodfacts.github.scrachx.openbeauty.yml        22-Feb-2021 12:18                6514
openfoodfacts.github.scrachx.openfood.yml          22-Feb-2021 12:18                9893
oppen.gemini.ariane.yml                            22-Feb-2021 12:18                 697
orbitlivewallpaperfree.puzzleduck.com.yml          22-Feb-2021 12:18                 900
org.ab.x48.yml                                     22-Feb-2021 12:18                 639
org.adaway.yml                                     22-Feb-2021 12:18               12389
org.adblockplus.android.yml                        22-Feb-2021 12:18                5470
org.addhen.smssync.yml                             22-Feb-2021 12:18                3110
org.adw.launcher.yml                               22-Feb-2021 12:18                 988
org.afhdownloader.yml                              22-Feb-2021 12:18                1538
org.aja.flightmode.yml                             22-Feb-2021 12:18                 894
org.akvo.rsr.up.yml                                22-Feb-2021 12:18                2084
org.ale.openwatch.yml                              22-Feb-2021 12:18                1096
org.ale.scanner.zotero.yml                         22-Feb-2021 12:18                 754
org.ametro.yml                                     22-Feb-2021 12:18                1622
org.aminb.mathtools.app.yml                        22-Feb-2021 12:18                1206
org.amoradi.syncopoli.yml                          22-Feb-2021 12:18                4523
org.andglkmod.hunkypunk.yml                        22-Feb-2021 12:18                2047
org.andresoviedo.dddmodel2.yml                     22-Feb-2021 12:18                1484
org.androidappdev.batterywidget.yml                22-Feb-2021 12:18                 532
org.androidappdev.wifiwidget.yml                   22-Feb-2021 12:18                 621
org.androidfromfrankfurt.archnews.yml              22-Feb-2021 12:18                1052
org.androidpn.client.yml                           22-Feb-2021 12:18                1201
org.androidsoft.app.permission.yml                 22-Feb-2021 12:18                1341
org.androidsoft.coloring.yml                       22-Feb-2021 12:18                1356
org.androidsoft.games.memory.kids.yml              22-Feb-2021 12:18                2282
org.androidsoft.games.memory.tux.yml               22-Feb-2021 12:18                1519
org.androidsoft.games.puzzle.kids.yml              22-Feb-2021 12:18                 738
org.androidsoft.games.slowit.yml                   22-Feb-2021 12:18                1433
org.androidsoft.opendata.remarkabletrees.yml       22-Feb-2021 12:18                2517
org.andstatus.app.yml                              22-Feb-2021 12:18               19630
org.andstatus.todoagenda.yml                       22-Feb-2021 12:18                3066
org.anhonesteffort.flock.yml                       22-Feb-2021 12:18                4523
org.anothermonitor.yml                             22-Feb-2021 12:18                1562
org.appsroid.fxpro.yml                             22-Feb-2021 12:18                 990
org.aprsdroid.app.yml                              22-Feb-2021 12:18                 750
org.ardour.yml                                     22-Feb-2021 12:18                 595
org.artsoft.rocksndiamonds.yml                     22-Feb-2021 12:18                1074
org.asdtm.fas.yml                                  22-Feb-2021 12:18                1118
org.asdtm.goodweather.yml                          22-Feb-2021 12:18                2411
org.asnelt.derandom.yml                            22-Feb-2021 12:18                1504
org.asteroidos.sync.yml                            22-Feb-2021 12:18                2321
org.astonbitecode.rustkeylock.yml                  22-Feb-2021 12:18                5836
org.atai.TessUI.yml                                22-Feb-2021 12:18                1858
org.atalk.android.yml                              22-Feb-2021 12:18               46534
org.aykit.MyOwnNotes.yml                           22-Feb-2021 12:18                1269
org.balau.fakedawn.yml                             22-Feb-2021 12:18                1139
org.bandev.buddhaquotes.yml                        22-Feb-2021 12:18                1511
org.basic.lg.yml                                   22-Feb-2021 12:18                 441
org.basketbuilddownloader.yml                      22-Feb-2021 12:18                1674
org.bc_bd.mrwhite.yml                              22-Feb-2021 12:18                1036
org.beide.bomber.yml                               22-Feb-2021 12:18                1133
org.beide.droidgain.yml                            22-Feb-2021 12:18                1577
org.berlin_vegan.bvapp.yml                         22-Feb-2021 12:18                4723
org.bienvenidoainternet.app.yml                    22-Feb-2021 12:18                1294
org.billthefarmer.accordion.yml                    22-Feb-2021 12:18                3844
org.billthefarmer.crossword.yml                    22-Feb-2021 12:18                2121
org.billthefarmer.currency.yml                     22-Feb-2021 12:18                4334
org.billthefarmer.diary.yml                        22-Feb-2021 12:18                7693
org.billthefarmer.editor.yml                       22-Feb-2021 12:18                5850
org.billthefarmer.melodeon.yml                     22-Feb-2021 12:18                3886
org.billthefarmer.notes.yml                        22-Feb-2021 12:18                1699
org.billthefarmer.scope.yml                        22-Feb-2021 12:18                3130
org.billthefarmer.shorty.yml                       22-Feb-2021 12:18                1959
org.billthefarmer.siggen.yml                       22-Feb-2021 12:18                2705
org.billthefarmer.tuner.yml                        22-Feb-2021 12:18                4216
org.birthdayadapter.yml                            22-Feb-2021 12:18                1938
org.bitbatzen.wlanscanner.yml                      22-Feb-2021 12:18                 659
org.bitbucket.tickytacky.mirrormirror.yml          22-Feb-2021 12:18                 751
org.blitzortung.android.app.yml                    22-Feb-2021 12:18                5383
org.blockinger.game.yml                            22-Feb-2021 12:18                1249
org.blokada.alarm.yml                              22-Feb-2021 12:18               19289
org.blokada.fem.fdroid.yml                         22-Feb-2021 12:18                5061
org.bobstuff.bobball.yml                           22-Feb-2021 12:18                2469
org.bombusmod.yml                                  22-Feb-2021 12:18                 928
org.bottiger.podcast.yml                           22-Feb-2021 12:18               30298
org.brandroid.openmanager.yml                      22-Feb-2021 12:18                2602
org.briarproject.briar.android.yml                 22-Feb-2021 12:18                4449
org.broeuschmeul.android.gps.bluetooth.provider..> 22-Feb-2021 12:18                1045
org.broeuschmeul.android.gps.usb.provider.yml      22-Feb-2021 12:18                 639
org.c_base.c_beam.yml                              22-Feb-2021 12:18                1948
org.calyxinstitute.vpn.yml                         22-Feb-2021 12:18                5463
org.catrobat.paintroid.yml                         22-Feb-2021 12:18                1175
org.chickenhook.binderfuzzy.yml                    22-Feb-2021 12:18                 539
org.chickenhook.startflagexploit.yml               22-Feb-2021 12:18                 743
org.chorem.android.saymytexts.yml                  22-Feb-2021 12:18                1337
org.chrisbailey.todo.yml                           22-Feb-2021 12:18                 658
org.ciasaboark.tacere.yml                          22-Feb-2021 12:18                1846
org.cipherdyne.fwknop2.yml                         22-Feb-2021 12:18                7265
org.cmotc.tools.rotationlockpp.yml                 22-Feb-2021 12:18                 951
org.commonvoice.saverio.yml                        22-Feb-2021 12:18                3696
org.congresointeractivo.elegilegi.yml              22-Feb-2021 12:18                 595
org.connectbot.yml                                 22-Feb-2021 12:18                4080
org.coolfrood.mytronome.yml                        22-Feb-2021 12:18                 518
org.coolreader.yml                                 22-Feb-2021 12:18               11516
org.courville.nova.yml                             22-Feb-2021 12:18               11232
org.covolunablu.marswallpaper.yml                  22-Feb-2021 12:18                 913
org.cprados.wificellmanager.yml                    22-Feb-2021 12:18                1595
org.creativecommons.thelist.yml                    22-Feb-2021 12:18                1685
org.crocodile.sbautologin.yml                      22-Feb-2021 12:18                 701
org.cry.otp.yml                                    22-Feb-2021 12:18                1170
org.csploit.android.yml                            22-Feb-2021 12:18                2353
org.cuberite.android.yml                           22-Feb-2021 12:18                 699
org.curiouscreature.android.shelves.yml            22-Feb-2021 12:18                 900
org.cyanogenmod.great.freedom.yml                  22-Feb-2021 12:18                1015
org.cyanogenmod.oneclick.yml                       22-Feb-2021 12:18                 957
org.cyanogenmod.wundergroundcmweatherprovider.yml  22-Feb-2021 12:18                1086
org.damazio.notifier.yml                           22-Feb-2021 12:18                1030
org.dash.electrum.electrum_dash.yml                22-Feb-2021 12:18               30947
org.daylightingsociety.wherearetheeyes.yml         22-Feb-2021 12:18                1552
org.ddosolitary.okcagent.yml                       22-Feb-2021 12:18                1276
org.de.jmg.learn.yml                               22-Feb-2021 12:18                1054
org.debian.eugen.headingcalculator.yml             22-Feb-2021 12:18                 751
org.decsync.cc.yml                                 22-Feb-2021 12:18                4060
org.decsync.sparss.floss.yml                       22-Feb-2021 12:18                3129
org.deluge.trireme.yml                             22-Feb-2021 12:18                4087
org.developfreedom.ccdroid.app.yml                 22-Feb-2021 12:18                1133
org.developfreedom.logmein.yml                     22-Feb-2021 12:18                 862
org.developfreedom.wordpowermadeeasy.yml           22-Feb-2021 12:18                1524
org.dgtale.icsimport.yml                           22-Feb-2021 12:18                1072
org.disroot.disrootapp.yml                         22-Feb-2021 12:18                3017
org.disrupted.rumble.yml                           22-Feb-2021 12:18                2339
org.diygenomics.pg.yml                             22-Feb-2021 12:18                 885
org.dmfs.tasks.yml                                 22-Feb-2021 12:18                7720
org.dnaq.dialer2.yml                               22-Feb-2021 12:18                 477
org.docspell.docspellshare.yml                     22-Feb-2021 12:18                 626
org.documentfoundation.libreoffice.yml             22-Feb-2021 12:18               20276
org.dolphinemu.dolphinemu.yml                      22-Feb-2021 12:18                3206
org.domogik.domodroid13.yml                        22-Feb-2021 12:18                7288
org.doubango.imsdroid.yml                          22-Feb-2021 12:18                1822
org.dpadgett.timer.yml                             22-Feb-2021 12:18                 841
org.droidparts.battery_widget.yml                  22-Feb-2021 12:18                 720
org.droidseries.yml                                22-Feb-2021 12:18                 659
org.droidtr.deletegapps.yml                        22-Feb-2021 12:18                3056
org.droidtr.keyboard.yml                           22-Feb-2021 12:18                5739
org.droidtr.termbin.yml                            22-Feb-2021 12:18                1182
org.droidupnp.yml                                  22-Feb-2021 12:18                2544
org.dsandler.apps.markers.yml                      22-Feb-2021 12:18                1412
org.dslul.openboard.inputmethod.latin.yml          22-Feb-2021 12:18                1038
org.durka.hallmonitor.yml                          22-Feb-2021 12:18                1275
org.dynalogin.android.yml                          22-Feb-2021 12:18                 778
org.dynamicsoft.caloriescope.yml                   22-Feb-2021 12:18                 658
org.dyndns.fules.ck.yml                            22-Feb-2021 12:18                1784
org.dyndns.ipignoli.petronius.yml                  22-Feb-2021 12:18                 552
org.dyndns.sven_ola.debian_kit.yml                 22-Feb-2021 12:18                1451
org.dyndns.warenix.web2pdf.yml                     22-Feb-2021 12:18                1192
org.dystopia.email.yml                             22-Feb-2021 12:18                2751
org.ea.sqrl.yml                                    22-Feb-2021 12:18                6943
org.easyrpg.player.yml                             22-Feb-2021 12:18                2561
org.edunivers.whereami.yml                         22-Feb-2021 12:18                 709
org.eehouse.android.xw4.yml                        22-Feb-2021 12:18               15834
org.eff.actioncenter.yml                           22-Feb-2021 12:18                1910
org.elijaxapps.androidxmrigminer.yml               22-Feb-2021 12:18                1940
org.emergent.android.weave.yml                     22-Feb-2021 12:18                 657
org.emunix.insteadlauncher.yml                     22-Feb-2021 12:18                1591
org.emunix.unipatcher.yml                          22-Feb-2021 12:18                2458
org.encointer.wallet.yml                           22-Feb-2021 12:18                6381
org.envaya.sms.yml                                 22-Feb-2021 12:18                1459
org.epstudios.epmobile.yml                         22-Feb-2021 12:18                3935
org.epstudios.morbidmeter.yml                      22-Feb-2021 12:18                1898
org.equeim.tremotesf.yml                           22-Feb-2021 12:18               15285
org.esteban.piano.yml                              22-Feb-2021 12:18                1317
org.ethack.orwall.yml                              22-Feb-2021 12:18                8133
org.eu.exodus_privacy.exodusprivacy.yml            22-Feb-2021 12:18                1545
org.eukalyptus.balance.yml                         22-Feb-2021 12:18                 542
org.eukalyptus.liquidrechner.yml                   22-Feb-2021 12:18                1022
org.evilsoft.pathfinder.reference.yml              22-Feb-2021 12:18                4378
org.example.pushupbuddy.yml                        22-Feb-2021 12:18                 992
org.example.rosary.yml                             22-Feb-2021 12:18                 853
org.fairphone.launcher.yml                         22-Feb-2021 12:18                1442
org.fastergps.yml                                  22-Feb-2021 12:18                3403
org.fdroid.basic.yml                               22-Feb-2021 12:18                1487
org.fdroid.fdroid.ota.yml                          22-Feb-2021 12:18                1377
org.fdroid.fdroid.privileged.ota.yml               22-Feb-2021 12:18                2897
org.fdroid.fdroid.privileged.yml                   22-Feb-2021 12:18                2423
org.fdroid.fdroid.yml                              22-Feb-2021 12:18               33799
org.fdroid.superuser.yml                           22-Feb-2021 12:18                4062
org.fedorahosted.freeotp.yml                       22-Feb-2021 12:18                1646
org.fitchfamily.android.dejavu.yml                 22-Feb-2021 12:18                3113
org.fitchfamily.android.gsmlocation.yml            22-Feb-2021 12:18                8222
org.fitchfamily.android.symphony.yml               22-Feb-2021 12:18                5055
org.fitchfamily.android.wifi_backend.yml           22-Feb-2021 12:18                7007
org.floens.chan.yml                                22-Feb-2021 12:18                8209
org.flyve.inventory.agent.yml                      22-Feb-2021 12:18                1522
org.flyve.mdm.agent.mqtt.yml                       22-Feb-2021 12:18                2549
org.flyve.mdm.agent.yml                            22-Feb-2021 12:18                2990
org.fosdem.yml                                     22-Feb-2021 12:18                1342
org.fossasia.badgemagic.yml                        22-Feb-2021 12:18                2084
org.fossasia.openevent.yml                         22-Feb-2021 12:18                1538
org.fossasia.pslab.yml                             22-Feb-2021 12:18                2039
org.fox.ttrss.yml                                  22-Feb-2021 12:18                7470
org.fox.tttrss.yml                                 22-Feb-2021 12:18                2238
org.freedombox.freedombox.yml                      22-Feb-2021 12:18                1077
org.freeminer.freeminer.yml                        22-Feb-2021 12:18                8685
org.freenetproject.mobile.yml                      22-Feb-2021 12:18                 841
org.freshrss.easyrss.yml                           22-Feb-2021 12:18                1803
org.froscon.schedule.yml                           22-Feb-2021 12:18                 710
org.galexander.sshd.yml                            22-Feb-2021 12:18                2973
org.gateshipone.malp.yml                           22-Feb-2021 12:18                3481
org.gateshipone.odyssey.yml                        22-Feb-2021 12:18                4447
org.gc.networktester.yml                           22-Feb-2021 12:18                1150
org.gdroid.gdroid.yml                              22-Feb-2021 12:18                4379
org.gege.caldavsyncadapter.yml                     22-Feb-2021 12:18                1410
org.geometerplus.fbreader.plugin.local_opds_sca..> 22-Feb-2021 12:18                1520
org.geometerplus.fbreader.plugin.tts.yml           22-Feb-2021 12:18                1040
org.geometerplus.zlibrary.ui.android.yml           22-Feb-2021 12:18               16621
org.getdisconnected.libreipsum.yml                 22-Feb-2021 12:18                1032
org.gfd.gsmlocation.yml                            22-Feb-2021 12:18                1592
org.ghostsinthelab.apps.guilelessbopomofo.yml      22-Feb-2021 12:18                2812
org.github.OxygenGuide.yml                         22-Feb-2021 12:18                 790
org.gitorious.jamesjrh.isokeys.yml                 22-Feb-2021 12:18                1368
org.gittner.osmbugs.yml                            22-Feb-2021 12:18                2863
org.glucosio.android.yml                           22-Feb-2021 12:18                3195
org.gmote.client.android.yml                       22-Feb-2021 12:18                1219
org.gnu.icecat.yml                                 22-Feb-2021 12:18               42061
org.gnucash.android.yml                            22-Feb-2021 12:18               12977
org.grapentin.apps.exceer.yml                      22-Feb-2021 12:18                1223
org.gringene.colourclock.yml                       22-Feb-2021 12:18                1265
org.gringene.concentricclock.yml                   22-Feb-2021 12:18                 977
org.handmadeideas.chordreader.yml                  22-Feb-2021 12:18                 779
org.hanenoshino.onscripter.yml                     22-Feb-2021 12:18                1314
org.happypeng.sumatora.android.sumatoradictiona..> 22-Feb-2021 12:18                2327
org.happysanta.gd.yml                              22-Feb-2021 12:18                1228
org.havenapp.main.yml                              22-Feb-2021 12:18                4196
org.hekmatof.chesswatch.yml                        22-Feb-2021 12:18                1112
org.helllabs.android.xmp.yml                       22-Feb-2021 12:18                6785
org.hermit.audalyzer.yml                           22-Feb-2021 12:18                 526
org.hermit.dazzle.yml                              22-Feb-2021 12:18                 653
org.hermit.netscramble.yml                         22-Feb-2021 12:18                 601
org.hermit.tricorder.yml                           22-Feb-2021 12:18                 895
org.herrlado.ask.languagepack.czech.yml            22-Feb-2021 12:18                1963
org.herrlado.ask.languagepack.lithuanian.yml       22-Feb-2021 12:18                2543
org.herrlado.geofonts.yml                          22-Feb-2021 12:18                1180
org.hiittimer.hiittimer.yml                        22-Feb-2021 12:18                 606
org.hlwd.bible.yml                                 22-Feb-2021 12:18                5228
org.hlwd.bible_multi_the_life.yml                  22-Feb-2021 12:18                5528
org.hoi_polloi.android.ringcode.yml                22-Feb-2021 12:18                1080
org.holylobster.nuntius.yml                        22-Feb-2021 12:18                1258
org.horaapps.leafpic.yml                           22-Feb-2021 12:18                2093
org.hwyl.sexytopo.yml                              22-Feb-2021 12:18                1798
org.hystudio.android.dosbox.yml                    22-Feb-2021 12:18                 614
org.icasdri.mather.yml                             22-Feb-2021 12:18                1186
org.iilab.openmentoring.yml                        22-Feb-2021 12:18                2512
org.iilab.pb.yml                                   22-Feb-2021 12:18                2115
org.indywidualni.fblite.yml                        22-Feb-2021 12:18                6026
org.inventati.massimol.liberovocab.yml             22-Feb-2021 12:18                 702
org.ironrabbit.bhoboard.yml                        22-Feb-2021 12:18                 793
org.ironrabbit.yml                                 22-Feb-2021 12:18                1112
org.isoron.uhabits.yml                             22-Feb-2021 12:18                6796
org.itishka.pointim.yml                            22-Feb-2021 12:18                2715
org.jak_linux.dns66.yml                            22-Feb-2021 12:18                3732
org.jamienicol.episodes.yml                        22-Feb-2021 12:18                1945
org.janb.shoppinglist.yml                          22-Feb-2021 12:18                1108
org.jdfossapps.android.shopwithmom.yml             22-Feb-2021 12:18                 585
org.jessies.dalvikexplorer.yml                     22-Feb-2021 12:18                1169
org.jessies.mathdroid.yml                          22-Feb-2021 12:18                1058
org.jf.Penroser.yml                                22-Feb-2021 12:18                 536
org.jfedor.frozenbubble.yml                        22-Feb-2021 12:18                8223
org.jfedor.nxtremotecontrol.yml                    22-Feb-2021 12:18                 803
org.jfet.batsHIIT.yml                              22-Feb-2021 12:18                3293
org.jitsi.meet.yml                                 22-Feb-2021 12:18               29637
org.jmoyer.NotificationPlus.yml                    22-Feb-2021 12:18                 595
org.jschwab.openrecipes.yml                        22-Feb-2021 12:18                4629
org.jsharkey.sky.yml                               22-Feb-2021 12:18                 435
org.jsl.shmp.yml                                   22-Feb-2021 12:18                1366
org.jsl.wfwt.yml                                   22-Feb-2021 12:18                2246
org.jtb.alogcat.yml                                22-Feb-2021 12:18                1874
org.jtb.droidlife.yml                              22-Feb-2021 12:18                 764
org.jtb.httpmon.yml                                22-Feb-2021 12:18                 523
org.jwz.xscreensaver.yml                           22-Feb-2021 12:18                1685
org.kaqui.yml                                      22-Feb-2021 12:18                8276
org.katsarov.dofcalc.yml                           22-Feb-2021 12:18                 537
org.katsarov.heatcalc.yml                          22-Feb-2021 12:18                 746
org.kaziprst.android.ndfilter.yml                  22-Feb-2021 12:18                 709
org.kde.bettercounter.yml                          22-Feb-2021 12:18                 914
org.kde.kdeconnect_tp.yml                          22-Feb-2021 12:18               10797
org.kde.ktrip.yml                                  22-Feb-2021 12:18                7148
org.kde.ministro.config.yml                        22-Feb-2021 12:18                 818
org.kde.necessitas.ministro.yml                    22-Feb-2021 12:18                1827
org.kiwix.kiwixcustomwikivoyageeurope.yml          22-Feb-2021 12:18                2624
org.kiwix.kiwixmobile.yml                          22-Feb-2021 12:18                6474
org.kknickkk.spider.yml                            22-Feb-2021 12:18                 962
org.kobuge.ninjatraining.yml                       22-Feb-2021 12:18                3028
org.kontalk.yml                                    22-Feb-2021 12:18               28267
org.kore.kolabnotes.android.yml                    22-Feb-2021 12:18               26685
org.koreader.launcher.yml                          22-Feb-2021 12:18               17348
org.kost.externalip.yml                            22-Feb-2021 12:18                 757
org.kost.nmap.android.networkmapper.yml            22-Feb-2021 12:18                1069
org.kreed.vanilla.yml                              22-Feb-2021 12:18                1132
org.kristbaum.como.yml                             22-Feb-2021 12:18                 571
org.krita.yml                                      22-Feb-2021 12:18               10113
org.kwaak3.yml                                     22-Feb-2021 12:18                 810
org.legtux.m_316k.fortune.yml                      22-Feb-2021 12:18                 916
org.legtux.m_316k.taptheblacktiles.yml             22-Feb-2021 12:18                 776
org.lenchan139.ncbookmark.yml                      22-Feb-2021 12:18                 858
org.lf_net.pgpunlocker.yml                         22-Feb-2021 12:18                1844
org.liberty.android.fantastischmemo.yml            22-Feb-2021 12:18                5812
org.liberty.android.freeotpplus.yml                22-Feb-2021 12:18                3334
org.libre.agosto.p2play.yml                        22-Feb-2021 12:18                 705
org.libreflix.app.yml                              22-Feb-2021 12:18                 735
org.libreoffice.impressremote.yml                  22-Feb-2021 12:18                2739
org.lichess.mobileapp.yml                          22-Feb-2021 12:18                 895
org.ligi.ajsha.yml                                 22-Feb-2021 12:18                1346
org.ligi.blexplorer.yml                            22-Feb-2021 12:18                1208
org.ligi.etheremote.yml                            22-Feb-2021 12:18                 838
org.ligi.fahrplan.yml                              22-Feb-2021 12:18                1735
org.ligi.fast.yml                                  22-Feb-2021 12:18                3935
org.ligi.faster.yml                                22-Feb-2021 12:18                1052
org.ligi.gobandroid_hd.yml                         22-Feb-2021 12:18               14646
org.ligi.ipfsdroid.yml                             22-Feb-2021 12:18                1633
org.ligi.materialteatimer.yml                      22-Feb-2021 12:18                1232
org.ligi.passandroid.yml                           22-Feb-2021 12:18               20872
org.ligi.satoshiproof.yml                          22-Feb-2021 12:18                1286
org.ligi.scr.yml                                   22-Feb-2021 12:18                1383
org.ligi.survivalmanual.yml                        22-Feb-2021 12:18                9147
org.ligi.vaporizercontrol.yml                      22-Feb-2021 12:18                1879
org.linaro.glmark2.yml                             22-Feb-2021 12:18                 694
org.linphone.yml                                   22-Feb-2021 12:18               25705
org.logicallycreative.movingpolygons.yml           22-Feb-2021 12:18                 631
org.lufebe16.pysolfc.yml                           22-Feb-2021 12:18                9511
org.lumicall.android.yml                           22-Feb-2021 12:18               19358
org.macno.puma.yml                                 22-Feb-2021 12:18                1897
org.madore.android.unicodeMap.yml                  22-Feb-2021 12:18                 991
org.marcus905.wifi.ace.yml                         22-Feb-2021 12:18                 820
org.mariotaku.imageviewergl.yml                    22-Feb-2021 12:18                 619
org.mariotaku.twidere.extension.twitlonger.yml     22-Feb-2021 12:18                1504
org.mariotaku.twidere.yml                          22-Feb-2021 12:18               67239
org.martus.android.yml                             22-Feb-2021 12:18                1968
org.materialos.icons.yml                           22-Feb-2021 12:18                1801
org.mattvchandler.a2050.yml                        22-Feb-2021 12:18                 933
org.mattvchandler.progressbars.yml                 22-Feb-2021 12:18                 978
org.mbach.lemonde.yml                              22-Feb-2021 12:18               10012
org.mcxa.softsound.yml                             22-Feb-2021 12:18                 760
org.mcxa.vortaro.yml                               22-Feb-2021 12:18                1137
org.mcxa.zephyrlogger.yml                          22-Feb-2021 12:18                 706
org.me.tvhguide.yml                                22-Feb-2021 12:18                 825
org.metabrainz.android.yml                         22-Feb-2021 12:18                 596
org.miamplayer.autoairplanemode.yml                22-Feb-2021 12:18                 809
org.mian.gitnex.yml                                22-Feb-2021 12:18                5086
org.michaelevans.nightmodeenabler.yml              22-Feb-2021 12:18                1314
org.microg.nlp.backend.apple.yml                   22-Feb-2021 12:18                2215
org.microg.nlp.backend.ichnaea.yml                 22-Feb-2021 12:18                1776
org.microg.nlp.backend.nominatim.yml               22-Feb-2021 12:18                1475
org.microg.nlp.backend.openwlanmap.yml             22-Feb-2021 12:18                1276
org.microg.nlp.yml                                 22-Feb-2021 12:18                4004
org.midorinext.android.yml                         22-Feb-2021 12:18                1837
org.mixare.yml                                     22-Feb-2021 12:18                1622
org.mmk2410.cyngn.theme.fira.yml                   22-Feb-2021 12:18                 908
org.moire.opensudoku.yml                           22-Feb-2021 12:18                2682
org.moire.ultrasonic.yml                           22-Feb-2021 12:18                3841
org.montrealtransit.android.schedule.stmbus.yml    22-Feb-2021 12:18                 636
org.montrealtransit.android.yml                    22-Feb-2021 12:18                1064
org.moparisthebest.appbak.yml                      22-Feb-2021 12:18                1259
org.moparisthebest.pageplus.yml                    22-Feb-2021 12:18                1323
org.mosad.seil0.projectlaogai.yml                  22-Feb-2021 12:18                1015
org.mosad.teapod.yml                               22-Feb-2021 12:18                 685
org.mosspaper.yml                                  22-Feb-2021 12:18                1212
org.mozc.android.inputmethod.japanese.yml          22-Feb-2021 12:18                3584
org.mozilla.fennec_fdroid.yml                      22-Feb-2021 12:18              559220
org.mozilla.klar.yml                               22-Feb-2021 12:18               47787
org.mozilla.mozstumbler.yml                        22-Feb-2021 12:18                8326
org.mozilla.rocket.yml                             22-Feb-2021 12:18                4600
org.mult.daap.yml                                  22-Feb-2021 12:18                1206
org.mumod.android.yml                              22-Feb-2021 12:18                1388
org.mupen64plusae.v3.alpha.yml                     22-Feb-2021 12:18                9362
org.musicbrainz.picard.barcodescanner.yml          22-Feb-2021 12:18                1707
org.musicpd.yml                                    22-Feb-2021 12:18                7856
org.mustard.android.yml                            22-Feb-2021 12:18                1560
org.mysociety.FixMyStreet.yml                      22-Feb-2021 12:18                1792
org.mythdroid.yml                                  22-Feb-2021 12:18                1718
org.n52.sosmobileclient.yml                        22-Feb-2021 12:18                 790
org.nathan.jf.build.prop.editor.yml                22-Feb-2021 12:18                1218
org.navitproject.navit.yml                         22-Feb-2021 12:18               27023
org.ncrmnt.nettts.yml                              22-Feb-2021 12:18                 896
org.ndeftools.boilerplate.yml                      22-Feb-2021 12:18                 970
org.nerdcircus.android.klaxon.yml                  22-Feb-2021 12:18                 654
org.nexttracks.android.yml                         22-Feb-2021 12:18                 620
org.nick.cryptfs.passwdmanager.yml                 22-Feb-2021 12:18                1739
org.nick.wwwjdic.yml                               22-Feb-2021 12:18                7767
org.ninthfloor.copperpdf.yml                       22-Feb-2021 12:18                1350
org.nitri.opentopo.yml                             22-Feb-2021 12:18                3010
org.nonononoki.hendroid.yml                        22-Feb-2021 12:18                4359
org.notabug.lifeuser.moviedb.yml                   22-Feb-2021 12:18                1270
org.npr.android.news.yml                           22-Feb-2021 12:18                1899
org.ntpsync.yml                                    22-Feb-2021 12:18                3367
org.numixproject.iconsubmit.yml                    22-Feb-2021 12:18                 976
org.nuntius35.wrongpinshutdown.yml                 22-Feb-2021 12:18                1467
org.nutritionfacts.dailydozen.yml                  22-Feb-2021 12:18                3203
org.nv95.openmanga.yml                             22-Feb-2021 12:18                1753
org.ocsinventoryng.android.agent.yml               22-Feb-2021 12:18                1372
org.odk.collect.android.yml                        22-Feb-2021 12:18                1882
org.og8.a1tox.yml                                  22-Feb-2021 12:18                 677
org.ogre.browser.yml                               22-Feb-2021 12:18               11003
org.okfn.pod.yml                                   22-Feb-2021 12:18                 901
org.olgsoft.apipepanic.yml                         22-Feb-2021 12:18                1830
org.olpc_france.sugarizer.yml                      22-Feb-2021 12:18                2408
org.openbmap.unifiedNlp.yml                        22-Feb-2021 12:18                3127
org.openbmap.yml                                   22-Feb-2021 12:18                5402
org.opendroidphp.yml                               22-Feb-2021 12:18                1620
org.openfoodfacts.scanner.yml                      22-Feb-2021 12:18                1710
org.opengappsdownloader.yml                        22-Feb-2021 12:18                1666
org.opengemara.shiurim.yml                         22-Feb-2021 12:18                 840
org.opengpx.yml                                    22-Feb-2021 12:18                1339
org.openhab.habdroid.beta.yml                      22-Feb-2021 12:18               55961
org.openhab.habdroid.yml                           22-Feb-2021 12:18                6467
org.openintents.about.yml                          22-Feb-2021 12:18                 981
org.openintents.filemanager.yml                    22-Feb-2021 12:18                5519
org.openintents.flashlight.yml                     22-Feb-2021 12:18                1180
org.openintents.notepad.yml                        22-Feb-2021 12:18                3103
org.openintents.safe.yml                           22-Feb-2021 12:18                1456
org.openintents.shopping.yml                       22-Feb-2021 12:18                3017
org.openlp.android.yml                             22-Feb-2021 12:18                 526
org.openlp.android2.yml                            22-Feb-2021 12:18                1392
org.openmsx.android.openmsx.yml                    22-Feb-2021 12:18                2672
org.openobservatory.ooniprobe.yml                  22-Feb-2021 12:18                9489
org.openorienteering.mapper.yml                    22-Feb-2021 12:18                3390
org.openpetfoodfacts.scanner.yml                   22-Feb-2021 12:18                5218
org.opensatnav.android.yml                         22-Feb-2021 12:18                 708
org.opentech.yml                                   22-Feb-2021 12:18                1190
org.openttd.sdl.yml                                22-Feb-2021 12:18                3218
org.osmdroid.yml                                   22-Feb-2021 12:18                1821
org.osmocom.tacdatabaseclient.yml                  22-Feb-2021 12:18                1494
org.ostrya.presencepublisher.yml                   22-Feb-2021 12:18                2850
org.pacien.tincapp.yml                             22-Feb-2021 12:18                5660
org.paladyn.mediclog.yml                           22-Feb-2021 12:18                2157
org.passwordmaker.android.yml                      22-Feb-2021 12:18                1447
org.paulmach.textedit.yml                          22-Feb-2021 12:18                1118
org.penghuang.tools.rotationlock.yml               22-Feb-2021 12:18                1254
org.peterbaldwin.client.android.tinyurl.yml        22-Feb-2021 12:18                 576
org.peterbaldwin.client.android.vlcremote.yml      22-Feb-2021 12:18                 801
org.petero.droidfish.yml                           22-Feb-2021 12:18               10519
org.pipoypipagames.cowsrevenge.yml                 22-Feb-2021 12:18                2440
org.pipoypipagames.towerjumper.yml                 22-Feb-2021 12:18                4295
org.piwigo.android.yml                             22-Feb-2021 12:18                 877
org.piwik.mobile2.yml                              22-Feb-2021 12:18                 786
org.pixmob.freemobile.netstat.yml                  22-Feb-2021 12:18                1529
org.pocketworkstation.pckeyboard.yml               22-Feb-2021 12:18                3826
org.poirsouille.tinc_gui.yml                       22-Feb-2021 12:18                2004
org.polaric.cyanogenmodchangelog.yml               22-Feb-2021 12:18                1463
org.poopeeland.tinytinyfeed.yml                    22-Feb-2021 12:18                1426
org.poul.bits.android.yml                          22-Feb-2021 12:18                 823
org.ppsspp.ppsspp.yml                              22-Feb-2021 12:18               13456
org.primftpd.yml                                   22-Feb-2021 12:18                6287
org.privacyhelper.yml                              22-Feb-2021 12:18                1951
org.projectmaxs.main.yml                           22-Feb-2021 12:18                7686
org.projectmaxs.module.alarmset.yml                22-Feb-2021 12:18                7608
org.projectmaxs.module.bluetooth.yml               22-Feb-2021 12:18               10215
org.projectmaxs.module.bluetoothadmin.yml          22-Feb-2021 12:18               10574
org.projectmaxs.module.clipboard.yml               22-Feb-2021 12:18               10218
org.projectmaxs.module.contactsread.yml            22-Feb-2021 12:18               11013
org.projectmaxs.module.fileread.yml                22-Feb-2021 12:18               10162
org.projectmaxs.module.filewrite.yml               22-Feb-2021 12:18               10530
org.projectmaxs.module.locationfine.yml            22-Feb-2021 12:18                7896
org.projectmaxs.module.misc.yml                    22-Feb-2021 12:18                7431
org.projectmaxs.module.nfc.yml                     22-Feb-2021 12:18                6492
org.projectmaxs.module.notification.yml            22-Feb-2021 12:18                7750
org.projectmaxs.module.phonestateread.yml          22-Feb-2021 12:18               10564
org.projectmaxs.module.ringermode.yml              22-Feb-2021 12:18               10299
org.projectmaxs.module.shell.yml                   22-Feb-2021 12:18                7787
org.projectmaxs.module.smsnotify.yml               22-Feb-2021 12:18               10275
org.projectmaxs.module.smsread.yml                 22-Feb-2021 12:18               10130
org.projectmaxs.module.smssend.yml                 22-Feb-2021 12:18               10404
org.projectmaxs.module.smswrite.yml                22-Feb-2021 12:18               10593
org.projectmaxs.module.wifiaccess.yml              22-Feb-2021 12:18                8006
org.projectmaxs.module.wifichange.yml              22-Feb-2021 12:18                7727
org.projectmaxs.transport.xmpp.yml                 22-Feb-2021 12:18                8931
org.projectvoodoo.otarootkeeper.yml                22-Feb-2021 12:18                1828
org.projectvoodoo.screentestpatterns.yml           22-Feb-2021 12:18                1142
org.projectvoodoo.simplecarrieriqdetector.yml      22-Feb-2021 12:18                1051
org.proninyaroslav.libretorrent.yml                22-Feb-2021 12:18                2828
org.pulpdust.lesserpad.yml                         22-Feb-2021 12:18                2677
org.purple.smoke.yml                               22-Feb-2021 12:18                2434
org.pyload.android.client.yml                      22-Feb-2021 12:18                1581
org.pyneo.maps.yml                                 22-Feb-2021 12:18                1897
org.qii.weiciyuan.yml                              22-Feb-2021 12:18                1356
org.quantumbadger.redreader.yml                    22-Feb-2021 12:18                6613
org.quovadit.apps.andof.yml                        22-Feb-2021 12:18                 883
org.recentwidget.yml                               22-Feb-2021 12:18                 660
org.redcross.openmapkit.yml                        22-Feb-2021 12:18                1785
org.retroarch.yml                                  22-Feb-2021 12:18                1999
org.retroshare.android.qml_app.yml                 22-Feb-2021 12:18                2446
org.rmll.yml                                       22-Feb-2021 12:18                 570
org.runnerup.free.yml                              22-Feb-2021 12:18                6710
org.runnerup.yml                                   22-Feb-2021 12:18               14096
org.safecoin.safeprice.yml                         22-Feb-2021 12:18                 560
org.safermobile.intheclear.yml                     22-Feb-2021 12:18                1029
org.sagemath.droid.yml                             22-Feb-2021 12:18                 959
org.saiditnet.redreader.yml                        22-Feb-2021 12:18                1445
org.sasehash.burgerwp.yml                          22-Feb-2021 12:18                 860
org.savapage.android.print.yml                     22-Feb-2021 12:18                1696
org.schabi.etherwake.yml                           22-Feb-2021 12:18                1838
org.schabi.jedentageinset.yml                      22-Feb-2021 12:18                 882
org.schabi.kiba.yml                                22-Feb-2021 12:18                1028
org.schabi.newpipe.yml                             22-Feb-2021 12:18               11108
org.schabi.newpipelegacy.yml                       22-Feb-2021 12:18                2665
org.schabi.nxbookmarks.owncloud.yml                22-Feb-2021 12:18                1620
org.schabi.nxbookmarks.yml                         22-Feb-2021 12:18                1914
org.schabi.openhitboxstreams.yml                   22-Feb-2021 12:18                 844
org.schabi.sharewithnewpipe.yml                    22-Feb-2021 12:18                1145
org.schabi.stethox.yml                             22-Feb-2021 12:18                1134
org.schabi.svgredirect.yml                         22-Feb-2021 12:18                 832
org.schabi.terminightor.yml                        22-Feb-2021 12:18                3113
org.scid.android.yml                               22-Feb-2021 12:18                2126
org.scoutant.blokish.yml                           22-Feb-2021 12:18                2521
org.scoutant.cc.yml                                22-Feb-2021 12:18                1284
org.scoutant.rpn.yml                               22-Feb-2021 12:18                 931
org.scummvm.scummvm.yml                            22-Feb-2021 12:18                3716
org.seamapdroid.yml                                22-Feb-2021 12:18                2120
org.secuso.privacyfriendly2048.yml                 22-Feb-2021 12:18                1501
org.secuso.privacyfriendlyactivitytracker.yml      22-Feb-2021 12:18                2132
org.secuso.privacyfriendlyboardgameclock.yml       22-Feb-2021 12:18                1506
org.secuso.privacyfriendlycardgameone.yml          22-Feb-2021 12:18                1655
org.secuso.privacyfriendlycircuittraining.yml      22-Feb-2021 12:18                2825
org.secuso.privacyfriendlydame.yml                 22-Feb-2021 12:18                1396
org.secuso.privacyfriendlydicer.yml                22-Feb-2021 12:18                1597
org.secuso.privacyfriendlyfinancemanager.yml       22-Feb-2021 12:18                2193
org.secuso.privacyfriendlyfoodtracker.yml          22-Feb-2021 12:18                2624
org.secuso.privacyfriendlyintervaltimer.yml        22-Feb-2021 12:18                1672
org.secuso.privacyfriendlyludo.yml                 22-Feb-2021 12:18                2248
org.secuso.privacyfriendlymemory.yml               22-Feb-2021 12:18                1519
org.secuso.privacyfriendlyminesweeper.yml          22-Feb-2021 12:18                2642
org.secuso.privacyfriendlynetmonitor.yml           22-Feb-2021 12:18                2165
org.secuso.privacyfriendlynotes.yml                22-Feb-2021 12:18                1460
org.secuso.privacyfriendlypaindiary.yml            22-Feb-2021 12:18                1404
org.secuso.privacyfriendlypasswordgenerator.yml    22-Feb-2021 12:18                1965
org.secuso.privacyfriendlypausinghealthily.yml     22-Feb-2021 12:18                1617
org.secuso.privacyfriendlypin.yml                  22-Feb-2021 12:18                1677
org.secuso.privacyfriendlyrecknoningskills.yml     22-Feb-2021 12:18                1818
org.secuso.privacyfriendlyruler.yml                22-Feb-2021 12:18                1462
org.secuso.privacyfriendlysketching.yml            22-Feb-2021 12:18                1846
org.secuso.privacyfriendlysolitaire.yml            22-Feb-2021 12:18                1960
org.secuso.privacyfriendlysudoku.yml               22-Feb-2021 12:18                3119
org.secuso.privacyfriendlytapemeasure.yml          22-Feb-2021 12:18                1810
org.secuso.privacyfriendlytodolist.yml             22-Feb-2021 12:18                1925
org.secuso.privacyfriendlyweather.yml              22-Feb-2021 12:18                2258
org.secuso.privacyfriendlywifimanager.yml          22-Feb-2021 12:18                2071
org.secuso.privacyfriendlyyahtzeedicer.yml         22-Feb-2021 12:18                1844
org.segin.bfinterpreter.yml                        22-Feb-2021 12:18                 871
org.segin.ttleditor.yml                            22-Feb-2021 12:18                2905
org.sensors2.osc.yml                               22-Feb-2021 12:18                1052
org.sensors2.pd.yml                                22-Feb-2021 12:18                 685
org.servDroid.web.yml                              22-Feb-2021 12:18                1111
org.servalproject.yml                              22-Feb-2021 12:18                3493
org.sge.haltestellenanzeige.yml                    22-Feb-2021 12:18                 573
org.shadowice.flocke.andotp.yml                    22-Feb-2021 12:18                4104
org.shirakumo.ocelot.yml                           22-Feb-2021 12:18                 995
org.shortcuts.yml                                  22-Feb-2021 12:18                1074
org.sickstache.yml                                 22-Feb-2021 12:18                1998
org.sipdroid.sipua.yml                             22-Feb-2021 12:18                1588
org.sixgun.ponyexpress.yml                         22-Feb-2021 12:18                 893
org.smblott.intentradio.yml                        22-Feb-2021 12:18                1851
org.smc.inputmethod.indic.yml                      22-Feb-2021 12:18                7336
org.smerty.zooborns.yml                            22-Feb-2021 12:18                 731
org.smssecure.smssecure.yml                        22-Feb-2021 12:18               20987
org.snikket.android.yml                            22-Feb-2021 12:18                1525
org.softcatala.traductor.yml                       22-Feb-2021 12:18                1411
org.softeg.slartus.forpdaplus.yml                  22-Feb-2021 12:18                8243
org.solovyev.android.calculator.yml                22-Feb-2021 12:18                2747
org.sorz.lab.tinykeepass.yml                       22-Feb-2021 12:18                1378
org.sparkleshare.android.yml                       22-Feb-2021 12:18                 876
org.spechide.btappnder.whatsapptransmitter.yml     22-Feb-2021 12:18                1140
org.strawberryforum.argentum.yml                   22-Feb-2021 12:18                 554
org.strawberryforum.pollywog.yml                   22-Feb-2021 12:18                 874
org.subsurface.yml                                 22-Feb-2021 12:18                1122
org.sudowars.yml                                   22-Feb-2021 12:18                 879
org.sufficientlysecure.ical.yml                    22-Feb-2021 12:18                2007
org.sufficientlysecure.keychain.yml                22-Feb-2021 12:18               16959
org.sufficientlysecure.localcalendar.yml           22-Feb-2021 12:18                2500
org.sufficientlysecure.standalonecalendar.yml      22-Feb-2021 12:18                1306
org.sufficientlysecure.termbot.yml                 22-Feb-2021 12:18                1974
org.sufficientlysecure.viewer.fontpack.yml         22-Feb-2021 12:18                1577
org.sufficientlysecure.viewer.yml                  22-Feb-2021 12:18               46970
org.sugr.gearshift.yml                             22-Feb-2021 12:18                5077
org.supertuxkart.stk.yml                           22-Feb-2021 12:18                9138
org.surrel.facebooknotifications.yml               22-Feb-2021 12:18                2138
org.surrel.messengerbypasser.yml                   22-Feb-2021 12:18                1258
org.sw24softwares.starkeverben.yml                 22-Feb-2021 12:18                1768
org.synergy.yml                                    22-Feb-2021 12:18                1280
org.systemcall.scores.yml                          22-Feb-2021 12:18                1380
org.t2.synconwifi.yml                              22-Feb-2021 12:18                1739
org.tamanegi.atmosphere.yml                        22-Feb-2021 12:18                 957
org.tamanegi.wallpaper.multipicture.dnt.yml        22-Feb-2021 12:18                1098
org.tasks.yml                                      22-Feb-2021 12:18               62454
org.tbrk.mnemododo.yml                             22-Feb-2021 12:18                1198
org.telegram.messenger.yml                         22-Feb-2021 12:18               47357
org.tengel.planisphere.yml                         22-Feb-2021 12:18                1285
org.tengel.timescale.yml                           22-Feb-2021 12:18                 677
org.tether.tether.yml                              22-Feb-2021 12:18                5411
org.thecongers.mtpms.yml                           22-Feb-2021 12:18                1759
org.thialfihar.android.apg.yml                     22-Feb-2021 12:18                1406
org.thiolliere.youtubestream.yml                   22-Feb-2021 12:18                1000
org.thosp.yourlocalweather.yml                     22-Feb-2021 12:18               10881
org.tigase.messenger.phone.pro.yml                 22-Feb-2021 12:18                1714
org.tilelessmap.app.yml                            22-Feb-2021 12:18                 856
org.tint.adblock.yml                               22-Feb-2021 12:18                 898
org.tint.yml                                       22-Feb-2021 12:18                1517
org.tlhInganHol.android.klingonassistant.yml       22-Feb-2021 12:18                2109
org.tmurakam.presentationtimer.yml                 22-Feb-2021 12:18                 964
org.tof.yml                                        22-Feb-2021 12:18                 704
org.tomdroid.yml                                   22-Feb-2021 12:18                1574
org.torproject.android.yml                         22-Feb-2021 12:18               32351
org.totschnig.myexpenses.yml                       22-Feb-2021 12:18               33373
org.totschnig.ocr.tesseract.yml                    22-Feb-2021 12:18                 746
org.totschnig.sendwithftp.yml                      22-Feb-2021 12:18                2008
org.toulibre.capitoledulibre.yml                   22-Feb-2021 12:18                1765
org.toulibre.cdl.yml                               22-Feb-2021 12:18                 840
org.traccar.client.yml                             22-Feb-2021 12:18                8672
org.transdroid.full.yml                            22-Feb-2021 12:18                9239
org.transdroid.lite.yml                            22-Feb-2021 12:18                5545
org.transdroid.search.yml                          22-Feb-2021 12:18                3530
org.transdroid.yml                                 22-Feb-2021 12:18                2250
org.tryton.client.yml                              22-Feb-2021 12:18                 684
org.ttrssreader.yml                                22-Feb-2021 12:18               16032
org.tunesremote.yml                                22-Feb-2021 12:18                 474
org.tuxpaint.yml                                   22-Feb-2021 12:18                5371
org.tvheadend.tvhguide.yml                         22-Feb-2021 12:18                 738
org.tw.onze.cmtheme.yml                            22-Feb-2021 12:18                2719
org.twelf.cmtheme.yml                              22-Feb-2021 12:18                4141
org.twistedappdeveloper.statocovid19italia.yml     22-Feb-2021 12:18                1466
org.uaraven.e.yml                                  22-Feb-2021 12:18                1007
org.us.andriod.yml                                 22-Feb-2021 12:18                 625
org.valos.isolmoa.yml                              22-Feb-2021 12:18                1225
org.vi_server.red_screen.yml                       22-Feb-2021 12:18                 910
org.videolan.vlc.yml                               22-Feb-2021 12:18              127183
org.voidptr.swpieview.yml                          22-Feb-2021 12:18                1149
org.voidsink.anewjkuapp.yml                        22-Feb-2021 12:18                8999
org.vono.narau.yml                                 22-Feb-2021 12:18                1182
org.vudroid.yml                                    22-Feb-2021 12:18                 693
org.wahtod.wififixer.yml                           22-Feb-2021 12:18                4337
org.walleth.yml                                    22-Feb-2021 12:18               12546
org.weilbach.splitbills.yml                        22-Feb-2021 12:18                2178
org.wentura.getflow.yml                            22-Feb-2021 12:18                 507
org.wheelmap.android.online.yml                    22-Feb-2021 12:18                1595
org.whitequark.sipcaller.yml                       22-Feb-2021 12:18                 874
org.wikilovesmonuments.yml                         22-Feb-2021 12:18                 742
org.wikimedia.commons.muzei.yml                    22-Feb-2021 12:18                 526
org.wikimedia.commons.wikimedia.yml                22-Feb-2021 12:18                 915
org.wikimedia.commons.yml                          22-Feb-2021 12:18                2436
org.wikipedia.yml                                  22-Feb-2021 12:18               20708
org.wiktionary.yml                                 22-Feb-2021 12:18                 716
org.wingy.chan.yml                                 22-Feb-2021 12:18                3886
org.witness.sscphase1.yml                          22-Feb-2021 12:18                3621
org.woheller69.weather.yml                         22-Feb-2021 12:18                1173
org.woltage.irssiconnectbot.yml                    22-Feb-2021 12:18                1342
org.wordpress.android.yml                          22-Feb-2021 12:18                5516
org.wownero.cyberwow.yml                           22-Feb-2021 12:18                3033
org.wroot.android.goldeneye.yml                    22-Feb-2021 12:18                 675
org.xapek.andiodine.yml                            22-Feb-2021 12:18                1124
org.xbmc.android.remote.yml                        22-Feb-2021 12:18                 876
org.xbmc.kodi.yml                                  22-Feb-2021 12:18                9589
org.xbmc.kore.yml                                  22-Feb-2021 12:18                2869
org.xcsoar.yml                                     22-Feb-2021 12:18                9288
org.xphnx.ameixa.yml                               22-Feb-2021 12:18                3800
org.xphnx.ameixamonochrome.yml                     22-Feb-2021 12:18                4117
org.xphnx.iconsubmit.yml                           22-Feb-2021 12:18                1957
org.xposeddownloader.yml                           22-Feb-2021 12:18                1514
org.y20k.escapepod.yml                             22-Feb-2021 12:18                2537
org.y20k.trackbook.yml                             22-Feb-2021 12:18                5407
org.y20k.transistor.yml                            22-Feb-2021 12:18                9635
org.yaaic.yml                                      22-Feb-2021 12:18                1712
org.yabause.android.yml                            22-Feb-2021 12:18                1245
org.yausername.dvd.yml                             22-Feb-2021 12:18                1626
org.yaxim.androidclient.yml                        22-Feb-2021 12:18                4496
org.yuttadhammo.BodhiTimer.yml                     22-Feb-2021 12:18                4249
org.yuttadhammo.tipitaka.yml                       22-Feb-2021 12:18                3523
org.zakky.memopad.yml                              22-Feb-2021 12:18                 762
org.zamedev.gloomydungeons1hardcore.opensource.yml 22-Feb-2021 12:18                2531
org.zamedev.gloomydungeons2.opensource.yml         22-Feb-2021 12:18                2480
org.zeitgeist.movement.yml                         22-Feb-2021 12:18                1611
org.zephyrsoft.checknetwork.yml                    22-Feb-2021 12:18                1561
org.zephyrsoft.sdbviewer.yml                       22-Feb-2021 12:18                1882
org.zephyrsoft.trackworktime.yml                   22-Feb-2021 12:18                3990
org.zeroxlab.zeroxbenchmark.yml                    22-Feb-2021 12:18                 877
org.zimmob.zimlx.yml                               22-Feb-2021 12:18                2090
org.zirco.yml                                      22-Feb-2021 12:18                1235
ovh.ice.icecons.yml                                22-Feb-2021 12:18                1382
pan.alexander.tordnscrypt.stable.yml               22-Feb-2021 12:18                1058
paulscode.android.mupen64plusae.yml                22-Feb-2021 12:18                2455
pc.javier.actualizadoropendns.yml                  22-Feb-2021 12:18                 951
pc.javier.seguime.yml                              22-Feb-2021 12:18                3560
pe.moe.nori.yml                                    22-Feb-2021 12:18                1465
peanutencryption.peanutencryption.yml              22-Feb-2021 12:18                1504
pk.contender.earmouse.yml                          22-Feb-2021 12:18                2345
pl.hypeapp.endoscope.yml                           22-Feb-2021 12:18                 955
pl.hypeapp.episodie.yml                            22-Feb-2021 12:18                1551
pl.kuben.progressapp.yml                           22-Feb-2021 12:18                1583
pl.librus.client.yml                               22-Feb-2021 12:18                2150
pl.narfsoftware.thermometer.yml                    22-Feb-2021 12:18                1120
pl.net.szafraniec.NFCKey.yml                       22-Feb-2021 12:18                2524
pl.net.szafraniec.NFCTagmaker.yml                  22-Feb-2021 12:18                1314
pl.nkg.geokrety.yml                                22-Feb-2021 12:18                2132
pl.sanszo.pcis.yml                                 22-Feb-2021 12:18                1413
player.efis.cfd.yml                                22-Feb-2021 12:18                4865
player.efis.data.eur.rus.yml                       22-Feb-2021 12:18                1283
player.efis.data.pan.arg.yml                       22-Feb-2021 12:18                1132
player.efis.data.sah.jap.yml                       22-Feb-2021 12:18                1176
player.efis.data.usa.can.yml                       22-Feb-2021 12:18                1178
player.efis.data.zar.aus.yml                       22-Feb-2021 12:18                1197
player.efis.mfd.yml                                22-Feb-2021 12:18                5689
player.efis.pfd.yml                                22-Feb-2021 12:18                6614
posidon.launcher.yml                               22-Feb-2021 12:18                1277
press.condense.www.yml                             22-Feb-2021 12:18                1429
priv.twoerner.brightnesswidget.yml                 22-Feb-2021 12:18                 530
privacyfriendlyshoppinglist.secuso.org.privacyf..> 22-Feb-2021 12:18                2144
pro.dbro.bart.yml                                  22-Feb-2021 12:18                1292
pro.kherel.selfprivacy.yml                         25-Feb-2021 12:47                 769
pro.oneredpixel.l9droid.yml                        22-Feb-2021 12:18                 676
pro.rudloff.lineageos_updater_shortcut.yml         22-Feb-2021 12:18                 590
pro.rudloff.muzei.commons.yml                      22-Feb-2021 12:18                 543
pro.rudloff.openvegemap.yml                        22-Feb-2021 12:18                1681
pro.rudloff.papercraft.yml                         22-Feb-2021 12:18                 988
protect.babymonitor.yml                            22-Feb-2021 12:18                1127
protect.babysleepsounds.yml                        22-Feb-2021 12:18                2022
protect.budgetwatch.yml                            22-Feb-2021 12:18                3341
protect.card_locker.yml                            22-Feb-2021 12:18                5751
protect.gift_card_guard.yml                        22-Feb-2021 12:18                1379
protect.rentalcalc.yml                             22-Feb-2021 12:18                1542
protect.videoeditor.yml                            22-Feb-2021 12:18                2279
pt.ipleiria.mymusicqoe.yml                         22-Feb-2021 12:18                1722
pt.isec.tp.am.yml                                  22-Feb-2021 12:18                 504
pt.joaomneto.titancompanion.yml                    22-Feb-2021 12:18                1819
pw.thedrhax.mosmetro.yml                           22-Feb-2021 12:18                3218
quickly.quit.yml                                   22-Feb-2021 12:18                1140
raele.concurseiro.yml                              22-Feb-2021 12:18                 794
raffarti.simpleadvancedmetronome.yml               22-Feb-2021 12:18                1466
re.indigo.epistolaire.yml                          22-Feb-2021 12:18                1061
re.jcg.playmusicexporter.yml                       22-Feb-2021 12:18                1510
remuco.client.android.yml                          22-Feb-2021 12:18                1015
rino.org.tethercompanion.yml                       22-Feb-2021 12:18                 861
rkr.simplekeyboard.inputmethod.yml                 22-Feb-2021 12:18                4886
ro.ciubex.dscautorename.yml                        22-Feb-2021 12:18                 989
ro.hume.cosmin.retrostack.yml                      22-Feb-2021 12:18                 619
ro.ieval.fonbot.yml                                22-Feb-2021 12:18                 940
ro.ioanm.fissh.yml                                 22-Feb-2021 12:18                 711
ro.mihai.tpt.yml                                   22-Feb-2021 12:18                3686
ro.ui.pttdroid.yml                                 22-Feb-2021 12:18                1457
ro.weednet.contactssync.yml                        22-Feb-2021 12:18                2635
rocks.poopjournal.flashy.yml                       22-Feb-2021 12:18                 751
rocks.poopjournal.morse.yml                        22-Feb-2021 12:18                2495
rocks.tbog.tblauncher.yml                          22-Feb-2021 12:18                1274
rodrigodavy.com.github.pixelartist.yml             22-Feb-2021 12:18                1262
rs.ltt.android.yml                                 22-Feb-2021 12:18                1174
rs.pedjaapps.alogcatroot.app.yml                   22-Feb-2021 12:18                1323
ru.equestriadev.mgke.yml                           22-Feb-2021 12:18                1365
ru.evgeniy.dpitunnel.yml                           22-Feb-2021 12:18                1916
ru.exlmoto.snood21.yml                             22-Feb-2021 12:18                 926
ru.gelin.android.browser.open.yml                  22-Feb-2021 12:18                 741
ru.gelin.android.sendtosd.yml                      22-Feb-2021 12:18                1773
ru.gelin.android.weather.notification.skin.bigg..> 22-Feb-2021 12:18                 700
ru.gelin.android.weather.notification.skin.blac..> 22-Feb-2021 12:18                1641
ru.gelin.android.weather.notification.skin.blac..> 22-Feb-2021 12:18                 723
ru.gelin.android.weather.notification.skin.whit..> 22-Feb-2021 12:18                1691
ru.gelin.android.weather.notification.skin.whit..> 22-Feb-2021 12:18                 723
ru.gelin.android.weather.notification.yml          22-Feb-2021 12:18                2900
ru.glesik.nostrangersms.yml                        22-Feb-2021 12:18                 905
ru.glesik.wifireminders.yml                        22-Feb-2021 12:18                1844
ru.henridellal.dialer.yml                          22-Feb-2021 12:18                1246
ru.henridellal.emerald.yml                         22-Feb-2021 12:18                2882
ru.henridellal.fsassist.yml                        22-Feb-2021 12:18                 523
ru.henridellal.patolli.yml                         22-Feb-2021 12:18                 803
ru.hyst329.openfool.yml                            22-Feb-2021 12:18                1579
ru.ifproject.android.afr.yml                       22-Feb-2021 12:18                1411
ru.meefik.busybox.yml                              22-Feb-2021 12:18                7234
ru.meefik.tzupdater.yml                            22-Feb-2021 12:18                1484
ru.moscow.tuzlukov.sergey.weatherlog.yml           22-Feb-2021 12:18                 889
ru.neverdark.silentnight.yml                       22-Feb-2021 12:18                 712
ru.o2genum.coregame.yml                            22-Feb-2021 12:18                 421
ru.playsoftware.j2meloader.yml                     22-Feb-2021 12:18                9328
ru.ra66it.updaterforspotify.yml                    22-Feb-2021 12:18                2419
ru.sash0k.bluetooth_terminal.yml                   22-Feb-2021 12:18                1032
ru.seva.finder.yml                                 22-Feb-2021 12:18                1508
ru.subprogram.paranoidsmsblocker.yml               22-Feb-2021 12:18                1004
ru.ttyh.neko259.notey.yml                          22-Feb-2021 12:18                 706
ru.valle.btc.yml                                   22-Feb-2021 12:18                2442
ru.yanus171.feedexfork.yml                         22-Feb-2021 12:18                6829
ru.zxalexis.ugaday.yml                             22-Feb-2021 12:18                1074
ru0xdc.rtkgps.yml                                  22-Feb-2021 12:18                1882
ryey.camcov.yml                                    22-Feb-2021 12:18                1584
ryey.colorsniffer.yml                              22-Feb-2021 12:18                 895
ryey.easer.beta.yml                                22-Feb-2021 12:18                3518
ryey.easer.yml                                     22-Feb-2021 12:18               16629
ryey.flock.yml                                     22-Feb-2021 12:18                1043
saschpe.contactevents.yml                          22-Feb-2021 12:18                3202
saschpe.poker.yml                                  22-Feb-2021 12:18                1164
science.iodev.fissh.yml                            22-Feb-2021 12:18                1819
science.itaintrocket.pomfshare.yml                 22-Feb-2021 12:18                 829
se.anyro.nfc_reader.yml                            22-Feb-2021 12:18                1197
se.bitcraze.crazyfliecontrol2.yml                  22-Feb-2021 12:18                3460
se.danielj.geometridestroyer.yml                   22-Feb-2021 12:18                 936
se.embargo.retroboy.yml                            22-Feb-2021 12:18                1747
se.erikofsweden.findmyphone.yml                    22-Feb-2021 12:18                1594
se.johanhil.clipboard.yml                          22-Feb-2021 12:18                 870
se.johanhil.duckduckgo.yml                         22-Feb-2021 12:18                1032
se.leap.bitmaskclient.yml                          22-Feb-2021 12:18               10373
se.leap.riseupvpn.yml                              22-Feb-2021 12:18                5957
se.lublin.mumla.yml                                22-Feb-2021 12:18                3635
se.manyver.yml                                     22-Feb-2021 12:18               62719
se.norenh.rkfread.yml                              22-Feb-2021 12:18                1111
se.oandell.riksdagen.yml                           22-Feb-2021 12:18                4861
se.pp.mc.android.Gerberoid.yml                     22-Feb-2021 12:18                 755
se.traffar.dot_race.yml                            22-Feb-2021 12:18                3252
se.tube42.drum.android.yml                         22-Feb-2021 12:18                3319
se.tube42.kidsmem.android.yml                      22-Feb-2021 12:18                1356
se.tube42.p9.android.yml                           22-Feb-2021 12:18                1897
seanfoy.wherering.yml                              22-Feb-2021 12:18                 819
search.searx.yml                                   22-Feb-2021 12:18                 522
security.pEp.yml                                   22-Feb-2021 12:18               25142
sh.ftp.rocketninelabs.meditationassistant.opens..> 22-Feb-2021 12:18               12320
sh.ikl.liteshort.yml                               22-Feb-2021 12:18                 585
si.modrajagoda.didi.yml                            22-Feb-2021 12:18                 830
siir.es.adbWireless.yml                            22-Feb-2021 12:18                1202
simple.reboot.com.yml                              22-Feb-2021 12:18                1710
site.leos.apps.lespas.yml                          22-Feb-2021 12:18                1106
site.leos.setter.yml                               22-Feb-2021 12:18                 625
sk.baka.aedict.yml                                 22-Feb-2021 12:18                 742
sk.halmi.fbeditplus.yml                            22-Feb-2021 12:18                 660
sk.madzik.android.logcatudp.yml                    22-Feb-2021 12:18                1019
sk.vx.connectbot.yml                               22-Feb-2021 12:18                1983
sonoroxadc.garethmurfin.co.uk.yml                  22-Feb-2021 12:18                 932
sony.hidden.servicemenu.yml                        22-Feb-2021 12:18                1105
souch.smp.yml                                      22-Feb-2021 12:18                2374
souch.smsbypass.yml                                22-Feb-2021 12:18                1671
space.bm835.pb.yml                                 22-Feb-2021 12:18                 667
space.kraut.schluessel.yml                         22-Feb-2021 12:18                 523
space.neothefox.laytray.yml                        22-Feb-2021 12:18                1286
st.wow.git.hrm.yml                                 22-Feb-2021 12:18                1804
starcom.snd.yml                                    22-Feb-2021 12:18                1019
steele.gerry.dotty.yml                             22-Feb-2021 12:18                 626
sterrenburg.github.flutterhole.yml                 22-Feb-2021 12:18                3294
streetwalrus.usbmountr.yml                         22-Feb-2021 12:18                2697
su.sadrobot.yashlang.yml                           22-Feb-2021 12:18                1602
su.xash.husky.yml                                  22-Feb-2021 12:18                 666
subins2000.manglish.yml                            22-Feb-2021 12:18                 903
subreddit.android.appstore.yml                     22-Feb-2021 12:18                1848
sun.bob.leela.yml                                  22-Feb-2021 12:18                1669
superfreeze.tool.android.yml                       22-Feb-2021 12:18                3157
superustats.tool.android.yml                       22-Feb-2021 12:18                 616
swati4star.createpdf.yml                           22-Feb-2021 12:18                3437
systems.byteswap.aiproute.yml                      22-Feb-2021 12:18                1026
szelok.app.twister.yml                             22-Feb-2021 12:18                 522
taco.apkmirror.yml                                 22-Feb-2021 12:18                2547
team.swing.pendulums.yml                           22-Feb-2021 12:18                1683
teamunguided.brighttime.yml                        22-Feb-2021 12:18                1132
teaonly.droideye.yml                               22-Feb-2021 12:18                1785
tech.projectmatris.antimalwareapp.yml              22-Feb-2021 12:18                1167
tech.ula.yml                                       22-Feb-2021 12:18                5565
tech.waelk.radioactive.metronome.yml               22-Feb-2021 12:18                 475
telegra.ph.yml                                     22-Feb-2021 12:18                1596
tf.nox.wifisetup.yml                               22-Feb-2021 12:18                 865
theakki.synctool.yml                               22-Feb-2021 12:18                1044
theredspy15.ltecleanerfoss.yml                     22-Feb-2021 12:18                2061
threads.server.yml                                 22-Feb-2021 12:18                2637
tk.al54.dev.badpixels.yml                          22-Feb-2021 12:18                 974
tk.elevenk.dailybread.yml                          22-Feb-2021 12:18                1098
tk.giesecke.disaster_radio.yml                     22-Feb-2021 12:18                 769
tk.giesecke.painlessmesh.yml                       22-Feb-2021 12:18                1301
tk.giesecke.phoenix.yml                            22-Feb-2021 12:18                2351
tk.jordynsmediagroup.simpleirc.fdroid.yml          22-Feb-2021 12:18                1988
tk.radioactivemineral.metronome.yml                22-Feb-2021 12:18                1002
tk.superl2.xwifi.yml                               22-Feb-2021 12:18                 956
tkj.android.homecontrol.mythmote.yml               22-Feb-2021 12:18                2100
tmendes.com.analyticalbalancedroid.yml             22-Feb-2021 12:18                 901
tmendes.com.waterydroid.yml                        22-Feb-2021 12:18                 583
tn.creativeteam.newyoutubelistingapp.yml           22-Feb-2021 12:18                 652
to.doc.android.ipv6config.yml                      22-Feb-2021 12:18                 923
to.networld.android.divedroid.yml                  22-Feb-2021 12:18                1298
tof.cv.mpp.yml                                     22-Feb-2021 12:18               19224
tomer.com.alwaysonamoledplugin.yml                 22-Feb-2021 12:18                 817
tool.fff.profilepicturegenerator.yml               22-Feb-2021 12:18                1093
tranquvis.simplesmsremote.yml                      22-Feb-2021 12:18                3719
trikita.obsqr.yml                                  22-Feb-2021 12:18                1856
trikita.slide.yml                                  22-Feb-2021 12:18                1488
trikita.talalarmo.yml                              22-Feb-2021 12:18                1349
tritop.android.SLWTrafficMeterWidget.yml           22-Feb-2021 12:18                 450
tritop.androidSLWCpuWidget.yml                     22-Feb-2021 12:18                 437
troop.com.freedcam.yml                             22-Feb-2021 12:18                1200
truewatcher.tower.yml                              22-Feb-2021 12:18                 822
tuioDroid.impl.yml                                 22-Feb-2021 12:18                 864
tv.piratemedia.lightcontroler.yml                  22-Feb-2021 12:18                2348
tw.com.daxia.virtualsoftkeys.yml                   22-Feb-2021 12:18                 738
tw.qtlin.mac.airunlocker.yml                       22-Feb-2021 12:18                1647
tyagi.shubham.customsearch.yml                     22-Feb-2021 12:18                 738
ua.gardenapple.itchupdater.yml                     22-Feb-2021 12:18                1058
ua.gardenapple.trylbry.yml                         22-Feb-2021 12:18                 538
uk.ac.cam.cl.dtg.android.barcodebox.yml            22-Feb-2021 12:18                 913
uk.ac.ed.inf.mandelbrotmaps.yml                    22-Feb-2021 12:18                 706
uk.ac.swansea.eduroamcat.yml                       22-Feb-2021 12:18                1534
uk.co.ashtonbrsc.android.intentintercept.yml       22-Feb-2021 12:18                2305
uk.co.bitethebullet.android.token.yml              22-Feb-2021 12:18                1224
uk.co.busydoingnothing.catverbs.yml                22-Feb-2021 12:18                 662
uk.co.busydoingnothing.prevo.yml                   22-Feb-2021 12:18                2562
uk.co.danieljarvis.android.flashback.yml           22-Feb-2021 12:18                 744
uk.co.jarofgreen.JustADamnCompass.yml              22-Feb-2021 12:18                 647
uk.co.keepawayfromfire.screens.yml                 22-Feb-2021 12:18                2051
uk.co.richyhbm.monochromatic.yml                   22-Feb-2021 12:18                2011
uk.co.yahoo.p1rpp.calendartrigger.yml              22-Feb-2021 12:18                1497
uk.org.boddie.android.weatherforecast.yml          22-Feb-2021 12:18                5704
uk.org.cardboardbox.wonderdroid.yml                22-Feb-2021 12:18                2072
uk.org.crimetalk.yml                               22-Feb-2021 12:18                1172
uk.org.ngo.squeezer.yml                            22-Feb-2021 12:18                1327
uk.sensoryunderload.infinilist.yml                 22-Feb-2021 12:18                 648
unisiegen.photographers.activity.yml               22-Feb-2021 12:18                1259
uobikiemukot.yaft.yml                              22-Feb-2021 12:18                1131
urbanstew.RehearsalAssistant.yml                   22-Feb-2021 12:18                1681
us.achromaticmetaphor.agram.yml                    22-Feb-2021 12:18                1311
us.achromaticmetaphor.imcktg.yml                   22-Feb-2021 12:18                 717
us.bravender.android.dongsa.yml                    22-Feb-2021 12:18                 739
us.feras.mdv.demo.yml                              22-Feb-2021 12:18                 899
us.koller.cameraroll.yml                           22-Feb-2021 12:18                1732
us.lindanrandy.cidrcalculator.yml                  22-Feb-2021 12:18                1311
us.shandian.giga.yml                               22-Feb-2021 12:18                 742
uscartools.USTravelConverter.yml                   22-Feb-2021 12:18                 591
ut.ewh.audiometrytest.yml                          22-Feb-2021 12:18                1135
vik.linx.stormify.yml                              22-Feb-2021 12:18                1000
vnd.blueararat.kaleidoscope6.yml                   22-Feb-2021 12:18                 956
vocabletrainer.heinecke.aron.vocabletrainer.yml    22-Feb-2021 12:18                2732
vu.de.urpool.quickdroid.yml                        22-Feb-2021 12:18                2154
wb.receiptspro.yml                                 22-Feb-2021 12:18                6388
wiseguys.radar.yml                                 22-Feb-2021 12:18                1378
ws.xsoh.etar.yml                                   22-Feb-2021 12:18                2999
wsdfhjxc.taponium.yml                              22-Feb-2021 12:18                 593
wseemann.media.romote.yml                          22-Feb-2021 12:18                4964
x1125io.initdlight.yml                             22-Feb-2021 12:18                1037
x653.all_in_gold.yml                               22-Feb-2021 12:18                 442
x653.bullseye.yml                                  22-Feb-2021 12:18                 760
xyz.deepdaikon.quinb.yml                           22-Feb-2021 12:18                1645
xyz.deepdaikon.xeonjia.yml                         22-Feb-2021 12:18                3213
xyz.deepdaikon.zoysii.yml                          22-Feb-2021 12:18                3942
xyz.hisname.fireflyiii.yml                         22-Feb-2021 12:18                8074
xyz.iridiumion.plucklockex.yml                     22-Feb-2021 12:18                1230
xyz.myachin.saveto.yml                             22-Feb-2021 12:18                 528
xyz.zedler.patrick.grocy.yml                       22-Feb-2021 12:18                 914
yellr.net.yellr_android.yml                        22-Feb-2021 12:18                 887
ymakei.vegetarian_journal.yml                      22-Feb-2021 12:18                1437
youten.redo.ble.ibeacondetector.yml                22-Feb-2021 12:18                 831
z4pp3r.flashlightwidget.yml                        22-Feb-2021 12:18                 636
za.co.lukestonehm.logicaldefence.yml               22-Feb-2021 12:18                3321
za.co.neilson.alarm.yml                            22-Feb-2021 12:18                 786
zame.GloomyDungeons.opensource.game.yml            22-Feb-2021 12:18                3040
zen.meditation.android.yml                         22-Feb-2021 12:18                1680